Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 1316812..1317307 | Replicon | chromosome |
Accession | NZ_LT706985 | ||
Organism | Propionimicrobium sp. Marseille-P3275 strain Marseille-P3275T |
Toxin (Protein)
Gene name | pasB | Uniprot ID | - |
Locus tag | CZ356_RS06310 | Protein ID | WP_076389876.1 |
Coordinates | 1316812..1317075 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | CZ356_RS06315 | Protein ID | WP_076389167.1 |
Coordinates | 1317059..1317307 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CZ356_RS06290 | 1313236..1313691 | + | 456 | WP_076389164.1 | cupin domain-containing protein | - |
CZ356_RS06295 | 1313855..1315957 | - | 2103 | WP_162272872.1 | hypothetical protein | - |
CZ356_RS06300 | 1316151..1316372 | + | 222 | WP_197684258.1 | type II toxin-antitoxin system HicA family toxin | - |
CZ356_RS06305 | 1316369..1316758 | + | 390 | WP_083655415.1 | hypothetical protein | - |
CZ356_RS06310 | 1316812..1317075 | - | 264 | WP_076389876.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CZ356_RS06315 | 1317059..1317307 | - | 249 | WP_076389167.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
CZ356_RS06320 | 1317359..1319722 | - | 2364 | WP_156874595.1 | class C sortase | - |
CZ356_RS06325 | 1319811..1321346 | - | 1536 | WP_076389169.1 | SpaH/EbpB family LPXTG-anchored major pilin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 9935.71 Da Isoelectric Point: 10.1761
>T293451 WP_076389876.1 NZ_LT706985:c1317075-1316812 [Propionimicrobium sp. Marseille-P3275]
MAWKIEVFAKADKSLRKLDRQVARKIVAALAELAELDDPRSRGKALTGNLVGLWRYRVGDYRLLCLIDDEVLVVLVVDVA
HRSKVYR
MAWKIEVFAKADKSLRKLDRQVARKIVAALAELAELDDPRSRGKALTGNLVGLWRYRVGDYRLLCLIDDEVLVVLVVDVA
HRSKVYR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|