Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 906728..907314 | Replicon | chromosome |
| Accession | NZ_LT706985 | ||
| Organism | Propionimicrobium sp. Marseille-P3275 strain Marseille-P3275T | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | CZ356_RS04360 | Protein ID | WP_197684252.1 |
| Coordinates | 907006..907314 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | CZ356_RS04355 | Protein ID | WP_076388868.1 |
| Coordinates | 906728..907015 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CZ356_RS04330 | 902496..903194 | - | 699 | WP_076388863.1 | hypothetical protein | - |
| CZ356_RS04335 | 903245..904534 | + | 1290 | WP_076388864.1 | magnesium transporter | - |
| CZ356_RS04340 | 904527..905015 | + | 489 | WP_076388865.1 | DUF1003 domain-containing protein | - |
| CZ356_RS04345 | 905212..906357 | + | 1146 | Protein_845 | Mrp/NBP35 family ATP-binding protein | - |
| CZ356_RS04350 | 906412..906597 | - | 186 | WP_076388867.1 | 50S ribosomal protein L28 | - |
| CZ356_RS04355 | 906728..907015 | - | 288 | WP_076388868.1 | putative addiction module antidote protein | Antitoxin |
| CZ356_RS04360 | 907006..907314 | - | 309 | WP_197684252.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| CZ356_RS04365 | 907634..909904 | + | 2271 | WP_076388870.1 | glycoside hydrolase family 3 C-terminal domain-containing protein | - |
| CZ356_RS04370 | 910006..911685 | - | 1680 | WP_076388871.1 | ribonuclease J | - |
| CZ356_RS04375 | 911734..912252 | + | 519 | WP_076388872.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11776.66 Da Isoelectric Point: 10.2255
>T293450 WP_197684252.1 NZ_LT706985:c907314-907006 [Propionimicrobium sp. Marseille-P3275]
IKQTDVYVRWFRRLKDVRGKARINIALQRCRVADEVVGDVKSVGDGVYELRVHTGHGYRLYYMVKGKEIMLLVVGGDKSS
QRRDIEQAKKLAAEIVEEGKWQ
IKQTDVYVRWFRRLKDVRGKARINIALQRCRVADEVVGDVKSVGDGVYELRVHTGHGYRLYYMVKGKEIMLLVVGGDKSS
QRRDIEQAKKLAAEIVEEGKWQ
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|