Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 576323..576896 | Replicon | chromosome |
Accession | NZ_LT706985 | ||
Organism | Propionimicrobium sp. Marseille-P3275 strain Marseille-P3275T |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | CZ356_RS02635 | Protein ID | WP_076388485.1 |
Coordinates | 576323..576670 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | CZ356_RS02640 | Protein ID | WP_076388487.1 |
Coordinates | 576657..576896 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CZ356_RS02615 | 572546..574012 | - | 1467 | WP_076388483.1 | FtsX-like permease family protein | - |
CZ356_RS02620 | 574013..574733 | - | 721 | Protein_515 | ABC transporter ATP-binding protein | - |
CZ356_RS02625 | 574848..575570 | + | 723 | WP_197684248.1 | sensor histidine kinase | - |
CZ356_RS02630 | 575563..576234 | + | 672 | WP_076389753.1 | response regulator transcription factor | - |
CZ356_RS02635 | 576323..576670 | - | 348 | WP_076388485.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
CZ356_RS02640 | 576657..576896 | - | 240 | WP_076388487.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
CZ356_RS02645 | 577610..578317 | + | 708 | WP_076388489.1 | DUF4433 domain-containing protein | - |
CZ356_RS09785 | 578781..579011 | + | 231 | WP_197684215.1 | hypothetical protein | - |
CZ356_RS09735 | 579352..579627 | + | 276 | WP_173818515.1 | hypothetical protein | - |
CZ356_RS02660 | 579676..579924 | - | 249 | WP_076388493.1 | ribbon-helix-helix domain-containing protein | - |
CZ356_RS02665 | 580186..580368 | + | 183 | WP_076388495.1 | hypothetical protein | - |
CZ356_RS02670 | 580640..581548 | - | 909 | WP_076388497.1 | 3'-5' exoribonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12700.56 Da Isoelectric Point: 9.1668
>T293448 WP_076388485.1 NZ_LT706985:c576670-576323 [Propionimicrobium sp. Marseille-P3275]
MRRGEIRLVNLDPVVGSESNKLRPCVIVSNNNANDTAELLGRGVVTVVPLTSNTMRVYPFQTLLDSADTGLGEDSKAQAE
QVRSVDVRRIGKKIGQLSMRQQFALDEALRLHLQL
MRRGEIRLVNLDPVVGSESNKLRPCVIVSNNNANDTAELLGRGVVTVVPLTSNTMRVYPFQTLLDSADTGLGEDSKAQAE
QVRSVDVRRIGKKIGQLSMRQQFALDEALRLHLQL
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|