Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YoeB-YefM |
Location | 25510..26048 | Replicon | plasmid 3 |
Accession | NZ_LT703507 | ||
Organism | Mycobacterium intracellulare subsp. chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera |
Toxin (Protein)
Gene name | relE | Uniprot ID | D5P5D7 |
Locus tag | CCZ12_RS30800 | Protein ID | WP_007172405.1 |
Coordinates | 25791..26048 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | M1FTM7 |
Locus tag | CCZ12_RS30795 | Protein ID | WP_007172404.1 |
Coordinates | 25510..25794 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CCZ12_RS30775 | 20643..22163 | - | 1521 | WP_007172379.1 | DUF4226 domain-containing protein | - |
CCZ12_RS30780 | 22385..23140 | - | 756 | WP_074021258.1 | DUF2637 domain-containing protein | - |
CCZ12_RS30785 | 23942..24664 | + | 723 | WP_139315444.1 | ParA family protein | - |
CCZ12_RS30790 | 24667..25428 | + | 762 | WP_023363524.1 | hypothetical protein | - |
CCZ12_RS30795 | 25510..25794 | + | 285 | WP_007172404.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
CCZ12_RS30800 | 25791..26048 | + | 258 | WP_007172405.1 | Txe/YoeB family addiction module toxin | Toxin |
CCZ12_RS30805 | 26263..26556 | - | 294 | WP_007172406.1 | hypothetical protein | - |
CCZ12_RS30810 | 26573..27571 | - | 999 | WP_101930848.1 | hypothetical protein | - |
CCZ12_RS30815 | 28370..28852 | + | 483 | WP_040624353.1 | hypothetical protein | - |
CCZ12_RS30820 | 28842..29942 | + | 1101 | WP_007172409.1 | tyrosine-type recombinase/integrase | - |
CCZ12_RS30825 | 30061..30273 | + | 213 | WP_007172410.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | eccA5 / esxN | 1..97266 | 97266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10156.56 Da Isoelectric Point: 9.8613
>T293446 WP_007172405.1 NZ_LT703507:25791-26048 [Mycobacterium intracellulare subsp. chimaera]
VRSINFDPAAWEDFLFWLASDRKTARRITRLIAEIQRNPFAGIGKPEPLKGELSGYWSRRIDDEHRIVYRADDHEIKILK
ARYHY
VRSINFDPAAWEDFLFWLASDRKTARRITRLIAEIQRNPFAGIGKPEPLKGELSGYWSRRIDDEHRIVYRADDHEIKILK
ARYHY
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y0THX2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | M1FTM7 |