Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 10567..11108 | Replicon | plasmid 3 |
Accession | NZ_LT703507 | ||
Organism | Mycobacterium intracellulare subsp. chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera |
Toxin (Protein)
Gene name | parE | Uniprot ID | D5P595 |
Locus tag | CCZ12_RS30715 | Protein ID | WP_007172365.1 |
Coordinates | 10567..10860 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A854I1S2 |
Locus tag | CCZ12_RS30720 | Protein ID | WP_040624378.1 |
Coordinates | 10857..11108 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CCZ12_RS32190 | 5897..6328 | - | 432 | WP_139315439.1 | hypothetical protein | - |
CCZ12_RS30695 | 6559..6831 | - | 273 | WP_139315440.1 | hypothetical protein | - |
CCZ12_RS32195 | 6955..7626 | - | 672 | WP_139315441.1 | hypothetical protein | - |
CCZ12_RS30700 | 7736..8815 | - | 1080 | WP_007172361.1 | hypothetical protein | - |
CCZ12_RS30705 | 8930..9628 | - | 699 | WP_139315442.1 | hypothetical protein | - |
CCZ12_RS30710 | 9642..10349 | - | 708 | WP_139315443.1 | hypothetical protein | - |
CCZ12_RS30715 | 10567..10860 | - | 294 | WP_007172365.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
CCZ12_RS30720 | 10857..11108 | - | 252 | WP_040624378.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
CCZ12_RS30725 | 11214..11720 | - | 507 | WP_007172367.1 | helix-turn-helix domain-containing protein | - |
CCZ12_RS30730 | 12027..12464 | + | 438 | WP_007172368.1 | WhiB family transcriptional regulator | - |
CCZ12_RS30735 | 12520..13110 | + | 591 | WP_023363514.1 | hypothetical protein | - |
CCZ12_RS32200 | 13073..13357 | + | 285 | WP_007172369.1 | hypothetical protein | - |
CCZ12_RS30740 | 13734..15596 | + | 1863 | WP_023363516.1 | helicase associated domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | eccA5 / esxN | 1..97266 | 97266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11261.74 Da Isoelectric Point: 6.9772
>T293445 WP_007172365.1 NZ_LT703507:c10860-10567 [Mycobacterium intracellulare subsp. chimaera]
VSAYVLSPAAQADLEQIWDYTHEHWGLDQAEQYLRELQRAIERAAANPRIGRACDEIRPGYRKLAAGSHMLFYRVTTQGF
LDVVRVLHQRMDVDRHL
VSAYVLSPAAQADLEQIWDYTHEHWGLDQAEQYLRELQRAIERAAANPRIGRACDEIRPGYRKLAAGSHMLFYRVTTQGF
LDVVRVLHQRMDVDRHL
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Y0TBP0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A854I1S2 |