Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Rv0298-Rv0299/- |
Location | 4544868..4545394 | Replicon | chromosome |
Accession | NZ_LT703505 | ||
Organism | Mycobacterium intracellulare subsp. chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera |
Toxin (Protein)
Gene name | Rv0299 | Uniprot ID | S4ZDZ6 |
Locus tag | CCZ12_RS21090 | Protein ID | WP_008259048.1 |
Coordinates | 4545092..4545394 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | Rv0298 | Uniprot ID | S4ZFD0 |
Locus tag | CCZ12_RS21085 | Protein ID | WP_008259047.1 |
Coordinates | 4544868..4545095 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CCZ12_RS21060 | 4539939..4540865 | - | 927 | WP_042912749.1 | MinD/ParA family protein | - |
CCZ12_RS21065 | 4541110..4542141 | - | 1032 | WP_042912751.1 | 6-phosphofructokinase | - |
CCZ12_RS21070 | 4542185..4543678 | - | 1494 | WP_042912754.1 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA | - |
CCZ12_RS21075 | 4543675..4543974 | - | 300 | WP_009952003.1 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC | - |
CCZ12_RS21080 | 4544074..4544730 | + | 657 | WP_087139897.1 | amino acid-binding protein | - |
CCZ12_RS21085 | 4544868..4545095 | + | 228 | WP_008259047.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
CCZ12_RS21090 | 4545092..4545394 | + | 303 | WP_008259048.1 | hypothetical protein | Toxin |
CCZ12_RS21095 | 4545510..4545818 | - | 309 | WP_008259049.1 | hypothetical protein | - |
CCZ12_RS21100 | 4545877..4548798 | - | 2922 | WP_014712101.1 | MMPL family transporter | - |
CCZ12_RS21105 | 4548795..4549199 | - | 405 | WP_008259052.1 | hypothetical protein | - |
CCZ12_RS21110 | 4549446..4549964 | + | 519 | WP_042912757.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10473.31 Da Isoelectric Point: 4.5636
>T293444 WP_008259048.1 NZ_LT703505:4545092-4545394 [Mycobacterium intracellulare subsp. chimaera]
MIAPGDIAPRRDTRRDLYVAVLSNAIHLAANTGRVIVCPFIPGKIPDDTMAMVVPLTQPEGTLLPELVQWLPTSALGEPI
GAVSAAALSEAMSIVTALIT
MIAPGDIAPRRDTRRDLYVAVLSNAIHLAANTGRVIVCPFIPGKIPDDTMAMVVPLTQPEGTLLPELVQWLPTSALGEPI
GAVSAAALSEAMSIVTALIT
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|