293440

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1503170..1503732 Replicon chromosome
Accession NZ_LT703505
Organism Mycobacterium intracellulare subsp. chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera

Toxin (Protein)


Gene name vapC Uniprot ID A0A081I0A5
Locus tag CCZ12_RS07500 Protein ID WP_036454801.1
Coordinates 1503364..1503732 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A081I0A4
Locus tag CCZ12_RS07495 Protein ID WP_036455532.1
Coordinates 1503170..1503367 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CCZ12_RS07460 1498274..1499419 - 1146 WP_179945068.1 hypothetical protein -
CCZ12_RS07465 1499549..1500622 + 1074 WP_042910932.1 redox-regulated ATPase YchF -
CCZ12_RS07470 1500639..1501379 + 741 WP_042910933.1 aminoglycoside 3'-phosphotransferase -
CCZ12_RS07475 1501467..1501751 + 285 WP_020821851.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
CCZ12_RS07480 1501766..1502011 + 246 WP_042910934.1 type II toxin-antitoxin system RelE/ParE family toxin -
CCZ12_RS07485 1502047..1502598 + 552 WP_036454798.1 VOC family protein -
CCZ12_RS07490 1502677..1503075 + 399 WP_036454800.1 VOC family protein -
CCZ12_RS07495 1503170..1503367 + 198 WP_036455532.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
CCZ12_RS07500 1503364..1503732 + 369 WP_036454801.1 type II toxin-antitoxin system VapC family toxin Toxin
CCZ12_RS07505 1503915..1504256 + 342 WP_172417493.1 hypothetical protein -
CCZ12_RS32385 1504342..1504701 + 360 WP_042910935.1 hypothetical protein -
CCZ12_RS07515 1504886..1505461 + 576 WP_075630262.1 C40 family peptidase -
CCZ12_RS07520 1505824..1506147 + 324 WP_036454806.1 antibiotic biosynthesis monooxygenase -
CCZ12_RS07525 1506185..1507018 - 834 WP_036454808.1 SAM-dependent methyltransferase -
CCZ12_RS07530 1507053..1507736 - 684 WP_036455537.1 hypothetical protein -
CCZ12_RS07535 1507883..1508092 + 210 WP_072501223.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13435.74 Da        Isoelectric Point: 6.4862

>T293440 WP_036454801.1 NZ_LT703505:1503364-1503732 [Mycobacterium intracellulare subsp. chimaera]
MILVDTAVWIDHLHTAELRLVKLLEIDQVGCHALVIEELALGSISRREVVLDLLANLRQFPTVQHAEILHLTGQRKLYGR
GLSAVDVHLMAAVALVEGAQLWTRDKRLKAASVDAGIALFDA

Download         Length: 369 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6871.88 Da        Isoelectric Point: 11.6072

>AT293440 WP_036455532.1 NZ_LT703505:1503170-1503367 [Mycobacterium intracellulare subsp. chimaera]
MRTTVTIDDDLLAKAAELTGVRENVALLREGLQTLIRVESARRLAALGGTDAGAVAAPRRRRGTG

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A081I0A5

Antitoxin

Source ID Structure
AlphaFold DB A0A081I0A4

References