293439

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-Phd
Location 1501467..1502011 Replicon chromosome
Accession NZ_LT703505
Organism Mycobacterium intracellulare subsp. chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera

Toxin (Protein)


Gene name relE Uniprot ID A0A854HUL3
Locus tag CCZ12_RS07480 Protein ID WP_042910934.1
Coordinates 1501766..1502011 (+) Length 82 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID S4Z4W6
Locus tag CCZ12_RS07475 Protein ID WP_020821851.1
Coordinates 1501467..1501751 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CCZ12_RS07450 1496541..1497140 - 600 WP_009953444.1 lipid droplet-associated protein -
CCZ12_RS07455 1497230..1498228 + 999 WP_042910931.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
CCZ12_RS07460 1498274..1499419 - 1146 WP_179945068.1 hypothetical protein -
CCZ12_RS07465 1499549..1500622 + 1074 WP_042910932.1 redox-regulated ATPase YchF -
CCZ12_RS07470 1500639..1501379 + 741 WP_042910933.1 aminoglycoside 3'-phosphotransferase -
CCZ12_RS07475 1501467..1501751 + 285 WP_020821851.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
CCZ12_RS07480 1501766..1502011 + 246 WP_042910934.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
CCZ12_RS07485 1502047..1502598 + 552 WP_036454798.1 VOC family protein -
CCZ12_RS07490 1502677..1503075 + 399 WP_036454800.1 VOC family protein -
CCZ12_RS07495 1503170..1503367 + 198 WP_036455532.1 type II toxin-antitoxin system VapB family antitoxin -
CCZ12_RS07500 1503364..1503732 + 369 WP_036454801.1 type II toxin-antitoxin system VapC family toxin -
CCZ12_RS07505 1503915..1504256 + 342 WP_172417493.1 hypothetical protein -
CCZ12_RS32385 1504342..1504701 + 360 WP_042910935.1 hypothetical protein -
CCZ12_RS07515 1504886..1505461 + 576 WP_075630262.1 C40 family peptidase -
CCZ12_RS07520 1505824..1506147 + 324 WP_036454806.1 antibiotic biosynthesis monooxygenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(29-80)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 82 a.a.        Molecular weight: 9380.95 Da        Isoelectric Point: 11.2612

>T293439 WP_042910934.1 NZ_LT703505:1501766-1502011 [Mycobacterium intracellulare subsp. chimaera]
MTAAAKRALTHLLPESVAIACWEFIRGPLAENPQRVGKPLRGQLEGRYSARRGEFRVIYRIFDERVVVPVIHIAHRRDVY
R

Download         Length: 246 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10513.88 Da        Isoelectric Point: 4.3705

>AT293439 WP_020821851.1 NZ_LT703505:1501467-1501751 [Mycobacterium intracellulare subsp. chimaera]
MSTLPLAEVRANLSKLVDEAVRTHERIEVTRQGRRAAVILSADDFDSIMETLAILSDQDLMREVRAAESEAEDGALYTLD
QVTEEMRAVGRLPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A854HUL3

Antitoxin

Source ID Structure
AlphaFold DB S4Z4W6

References