Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 1259518..1260171 | Replicon | chromosome |
Accession | NZ_LT703505 | ||
Organism | Mycobacterium intracellulare subsp. chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | CCZ12_RS06340 | Protein ID | WP_008253911.1 |
Coordinates | 1259710..1260171 (+) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | X8A187 |
Locus tag | CCZ12_RS06335 | Protein ID | WP_009957321.1 |
Coordinates | 1259518..1259706 (+) | Length | 63 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CCZ12_RS06325 | 1255491..1257068 | + | 1578 | WP_042911067.1 | serine hydrolase | - |
CCZ12_RS06330 | 1257065..1259452 | + | 2388 | WP_042910814.1 | cation-translocating P-type ATPase | - |
CCZ12_RS06335 | 1259518..1259706 | + | 189 | WP_009957321.1 | antitoxin | Antitoxin |
CCZ12_RS06340 | 1259710..1260171 | + | 462 | WP_008253911.1 | SRPBCC family protein | Toxin |
CCZ12_RS06345 | 1260258..1261028 | + | 771 | WP_042910815.1 | VOC family protein | - |
CCZ12_RS06350 | 1261102..1261536 | + | 435 | WP_008253914.1 | hypothetical protein | - |
CCZ12_RS06355 | 1261541..1262029 | - | 489 | WP_036454690.1 | glyoxalase/bleomycin resistance/dioxygenase family protein | - |
CCZ12_RS06360 | 1262029..1263543 | - | 1515 | WP_042910816.1 | carotenoid oxygenase family protein | - |
CCZ12_RS06365 | 1263546..1264766 | - | 1221 | WP_042910817.1 | acetyl-CoA acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 16639.20 Da Isoelectric Point: 8.5617
>T293438 WP_008253911.1 NZ_LT703505:1259710-1260171 [Mycobacterium intracellulare subsp. chimaera]
MAKLSGSIDVPLPPEVAWQHASDLSRYKDWLTIHRVWRSALPDEIEKGSVVESIVEVKGMPNRIKWTVVRYKPPEGMTLN
GDGVGGVKVKLMAKIQPKGDGSLVSFDVHLGGPALFGPIGMIVAAALRGDIDQSLENFVTVFTRPDPSSNGHR
MAKLSGSIDVPLPPEVAWQHASDLSRYKDWLTIHRVWRSALPDEIEKGSVVESIVEVKGMPNRIKWTVVRYKPPEGMTLN
GDGVGGVKVKLMAKIQPKGDGSLVSFDVHLGGPALFGPIGMIVAAALRGDIDQSLENFVTVFTRPDPSSNGHR
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|