Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 973253..973920 | Replicon | chromosome |
Accession | NZ_LT703505 | ||
Organism | Mycobacterium intracellulare subsp. chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera |
Toxin (Protein)
Gene name | vapC | Uniprot ID | D5PE24 |
Locus tag | CCZ12_RS04860 | Protein ID | WP_007168407.1 |
Coordinates | 973528..973920 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | D5PE23 |
Locus tag | CCZ12_RS04855 | Protein ID | WP_007168406.1 |
Coordinates | 973253..973528 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CCZ12_RS32325 | 968757..969083 | - | 327 | WP_033711234.1 | hypothetical protein | - |
CCZ12_RS04830 | 969073..969306 | - | 234 | Protein_942 | transposase | - |
CCZ12_RS04835 | 969324..970535 | - | 1212 | Protein_943 | ISL3 family transposase | - |
CCZ12_RS04840 | 970674..971306 | - | 633 | Protein_944 | DDE-type integrase/transposase/recombinase | - |
CCZ12_RS31660 | 971300..971389 | - | 90 | Protein_945 | SDR family oxidoreductase | - |
CCZ12_RS04845 | 971442..972145 | - | 704 | Protein_946 | histidine phosphatase family protein | - |
CCZ12_RS04850 | 972228..973100 | + | 873 | WP_007168405.1 | MaoC family dehydratase N-terminal domain-containing protein | - |
CCZ12_RS04855 | 973253..973528 | + | 276 | WP_007168406.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
CCZ12_RS04860 | 973528..973920 | + | 393 | WP_007168407.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
CCZ12_RS04865 | 974068..975227 | - | 1160 | Protein_950 | trehalose-phosphatase | - |
CCZ12_RS04870 | 975269..976607 | - | 1339 | Protein_951 | DUF1298 domain-containing protein | - |
CCZ12_RS31665 | 976869..976991 | - | 123 | Protein_952 | IS1595 family transposase | - |
CCZ12_RS04880 | 977327..978661 | + | 1335 | Protein_953 | IS1182 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14305.73 Da Isoelectric Point: 10.5032
>T293436 WP_007168407.1 NZ_LT703505:973528-973920 [Mycobacterium intracellulare subsp. chimaera]
MAAIYLDSSAIVKLAVREPESDALRRYLRTRLPRVSSALARTEVMRALLHKGESARRAGRRALASLDLLRIDNRLLDLAG
GLLPIELRTLDAIHLATAQRLGMDLGRLCTYDDRMRDAAEALGMAVIAPS
MAAIYLDSSAIVKLAVREPESDALRRYLRTRLPRVSSALARTEVMRALLHKGESARRAGRRALASLDLLRIDNRLLDLAG
GLLPIELRTLDAIHLATAQRLGMDLGRLCTYDDRMRDAAEALGMAVIAPS
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1X1XV84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1X1XUZ3 |