Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Rv0298-Rv0299/- |
| Location | 864281..864810 | Replicon | chromosome |
| Accession | NZ_LT703505 | ||
| Organism | Mycobacterium intracellulare subsp. chimaera strain Mycobacterium chimaera MC045 isolate Mycobacterium chimaera | ||
Toxin (Protein)
| Gene name | Rv0299 | Uniprot ID | X7VD93 |
| Locus tag | CCZ12_RS04375 | Protein ID | WP_007172144.1 |
| Coordinates | 864281..864586 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | Rv0298 | Uniprot ID | A0A1X1WNE2 |
| Locus tag | CCZ12_RS04380 | Protein ID | WP_042910679.1 |
| Coordinates | 864583..864810 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CCZ12_RS32300 | 859359..859499 | + | 141 | WP_007172137.1 | hypothetical protein | - |
| CCZ12_RS04350 | 859496..859882 | + | 387 | WP_007172138.1 | YbaB/EbfC family nucleoid-associated protein | - |
| CCZ12_RS04355 | 859952..860629 | + | 678 | WP_101930854.1 | hypothetical protein | - |
| CCZ12_RS04360 | 860629..860961 | + | 333 | WP_033717256.1 | hypothetical protein | - |
| CCZ12_RS04365 | 861249..861536 | + | 288 | WP_007172141.1 | hypothetical protein | - |
| CCZ12_RS32305 | 861555..863909 | + | 2355 | WP_007172142.1 | hypothetical protein | - |
| CCZ12_RS04375 | 864281..864586 | - | 306 | WP_007172144.1 | hypothetical protein | Toxin |
| CCZ12_RS04380 | 864583..864810 | - | 228 | WP_042910679.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| CCZ12_RS04390 | 865296..866786 | + | 1491 | WP_007172147.1 | type VII secretion protein EccB | - |
| CCZ12_RS04395 | 866860..867915 | + | 1056 | WP_007172148.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 10428.23 Da Isoelectric Point: 3.9382
>T293435 WP_007172144.1 NZ_LT703505:c864586-864281 [Mycobacterium intracellulare subsp. chimaera]
VITPGDITPGRDTNQELYVVVLSNTIHLAAATGQVIICPFIPGEIPSSTMAMIVTVLQPKGVVLPELIQWLPVAALDQPI
GNIGGIALADTTTTAVTALIS
VITPGDITPGRDTNQELYVVVLSNTIHLAAATGQVIICPFIPGEIPSSTMAMIVTVLQPKGVVLPELIQWLPVAALDQPI
GNIGGIALADTTTTAVTALIS
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X1XDZ0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X1WNE2 |