Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 2046887..2047370 | Replicon | chromosome |
Accession | NZ_LT635772 | ||
Organism | Anaerococcus mediterraneensis strain Marseille-P2765T |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | BQ4451_RS10025 | Protein ID | WP_072537996.1 |
Coordinates | 2046887..2047159 (-) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | BQ4451_RS10030 | Protein ID | WP_072537997.1 |
Coordinates | 2047143..2047370 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BQ4451_RS10015 | 2043993..2045201 | - | 1209 | WP_072537994.1 | hypothetical protein | - |
BQ4451_RS10020 | 2045429..2046238 | + | 810 | WP_072537995.1 | Cof-type HAD-IIB family hydrolase | - |
BQ4451_RS10025 | 2046887..2047159 | - | 273 | WP_072537996.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
BQ4451_RS10030 | 2047143..2047370 | - | 228 | WP_072537997.1 | hypothetical protein | Antitoxin |
BQ4451_RS10035 | 2047859..2052241 | - | 4383 | WP_083432108.1 | G5 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10891.98 Da Isoelectric Point: 10.2139
>T293415 WP_072537996.1 NZ_LT635772:c2047159-2046887 [Anaerococcus mediterraneensis]
MSSVYRFEYHKRVLKQLKKMDKSVQKLIISYIEKNLLYCDDPRKLGKALVGDKRGYWRYRIGPYRLICLIEDDKLLILAL
ELGHRREVYK
MSSVYRFEYHKRVLKQLKKMDKSVQKLIISYIEKNLLYCDDPRKLGKALVGDKRGYWRYRIGPYRLICLIEDDKLLILAL
ELGHRREVYK
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|