Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 1363019..1363499 | Replicon | chromosome |
| Accession | NZ_LT635480 | ||
| Organism | Ndongobacter massiliensis strain Marseille-P3170T | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | BQ7385_RS06610 | Protein ID | WP_072514801.1 |
| Coordinates | 1363019..1363285 (-) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | BQ7385_RS06615 | Protein ID | WP_072514802.1 |
| Coordinates | 1363272..1363499 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ7385_RS06595 | 1359225..1361000 | - | 1776 | WP_072514798.1 | aminopeptidase P family protein | - |
| BQ7385_RS06600 | 1361083..1361616 | - | 534 | WP_072514799.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| BQ7385_RS06605 | 1361859..1362962 | + | 1104 | WP_072514800.1 | redox-regulated ATPase YchF | - |
| BQ7385_RS06610 | 1363019..1363285 | - | 267 | WP_072514801.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| BQ7385_RS06615 | 1363272..1363499 | - | 228 | WP_072514802.1 | antitoxin | Antitoxin |
| BQ7385_RS06620 | 1363590..1365014 | - | 1425 | WP_072514803.1 | FHA domain-containing protein | - |
| BQ7385_RS06625 | 1365016..1365591 | - | 576 | WP_072514804.1 | prepilin peptidase | - |
| BQ7385_RS06630 | 1365596..1366891 | - | 1296 | WP_072514805.1 | CpaF family protein | - |
| BQ7385_RS06635 | 1366873..1367976 | - | 1104 | WP_072514806.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1302447..1450264 | 147817 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10598.35 Da Isoelectric Point: 10.8167
>T293414 WP_072514801.1 NZ_LT635480:c1363285-1363019 [Ndongobacter massiliensis]
MKKYEIELTERFKKDFRKLDRYTQKIIRAWMNKNLVACENPRQHGKGLTANRSGQWRYRIGSYRLIATIDDNKLIILALS
VGHRREIY
MKKYEIELTERFKKDFRKLDRYTQKIIRAWMNKNLVACENPRQHGKGLTANRSGQWRYRIGSYRLIATIDDNKLIILALS
VGHRREIY
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|