Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 45411..45952 Replicon chromosome
Accession NZ_LT634361
Organism Tenacibaculum maritimum NCIMB 2154

Toxin (Protein)


Gene name parE Uniprot ID A0A5S9RMS4
Locus tag MARIT_RS00275 Protein ID WP_024742611.1
Coordinates 45650..45952 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A5S9UJX4
Locus tag MARIT_RS00270 Protein ID WP_024742610.1
Coordinates 45411..45653 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MARIT_RS15365 40606..40764 + 159 WP_157926154.1 hypothetical protein -
MARIT_RS00225 41151..41372 + 222 WP_024742585.1 hypothetical protein -
MARIT_RS00230 41397..41762 + 366 WP_024742586.1 hypothetical protein -
MARIT_RS00235 41768..42187 + 420 WP_024742587.1 hypothetical protein -
MARIT_RS00240 42295..42564 - 270 WP_100210473.1 transposase -
MARIT_RS00245 42607..42882 - 276 Protein_50 transposase -
MARIT_RS00250 43078..43872 + 795 WP_024742561.1 hypothetical protein -
MARIT_RS00255 44027..44311 + 285 WP_038026438.1 hypothetical protein -
MARIT_RS00260 44315..44761 + 447 WP_024742562.1 hypothetical protein -
MARIT_RS15670 44973..45131 - 159 Protein_54 transposase -
MARIT_RS00270 45411..45653 + 243 WP_024742610.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
MARIT_RS00275 45650..45952 + 303 WP_024742611.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
MARIT_RS15370 46488..46646 - 159 WP_157926155.1 hypothetical protein -
MARIT_RS00280 46995..48179 + 1185 WP_024742007.1 hypothetical protein -
MARIT_RS00285 48279..49103 + 825 WP_024742008.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-94)

Antitoxin

Antitoxin ParD

(1-79)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 12247.19 Da        Isoelectric Point: 10.0966

>T293411 WP_024742611.1 NZ_LT634361:45650-45952 [Tenacibaculum maritimum NCIMB 2154]
MSKNKYRISQQAIEDLDNIWIYTLNKWSKEQADRYYDLIITEIEFIADNFMTGKSAEQTRKNYRVTKIKSHLIFYRKMEN
DIVEIVRVLHQRMDVKKRLK

Download         Length: 303 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9320.56 Da        Isoelectric Point: 7.4044

>AT293411 WP_024742610.1 NZ_LT634361:45411-45653 [Tenacibaculum maritimum NCIMB 2154]
MGKNTSISLGNHFEDFIREEVKSGRYGSVSEVIRSALRLLEREEKKERELIKALEVGENSGFVENFDPKQHLKELHRKHL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5S9RMS4

Antitoxin

Source ID Structure
AlphaFold DB A0A5S9UJX4

References