Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 2639884..2640473 | Replicon | chromosome |
Accession | NZ_LT630450 | ||
Organism | Desulfovibrio piger strain FI11049 isolate FI11049 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | DESPIGER_RS11750 | Protein ID | WP_072337186.1 |
Coordinates | 2640141..2640473 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | DESPIGER_RS11745 | Protein ID | WP_072337184.1 |
Coordinates | 2639884..2640141 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DESPIGER_RS12715 | 2638771..2638944 | - | 174 | WP_083575400.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
DESPIGER_RS11740 | 2639040..2639795 | - | 756 | WP_156831704.1 | hypothetical protein | - |
DESPIGER_RS11745 | 2639884..2640141 | + | 258 | WP_072337184.1 | antitoxin | Antitoxin |
DESPIGER_RS11750 | 2640141..2640473 | + | 333 | WP_072337186.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DESPIGER_RS11755 | 2640490..2642265 | - | 1776 | WP_072337187.1 | TraM recognition domain-containing protein | - |
DESPIGER_RS11760 | 2642273..2643592 | - | 1320 | WP_072337189.1 | hypothetical protein | - |
DESPIGER_RS11765 | 2643589..2644101 | - | 513 | WP_083575402.1 | lytic transglycosylase domain-containing protein | - |
DESPIGER_RS11770 | 2644098..2644514 | - | 417 | WP_072337191.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2627314..2666834 | 39520 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11989.78 Da Isoelectric Point: 8.5532
>T293399 WP_072337186.1 NZ_LT630450:2640141-2640473 [Desulfovibrio piger]
MRRGDIYLVTLDPTEGHEQQGTRPVLVISPDEFNRVTQVPVVLPITSGGNFARTAGFAVSLSGCGTRTTGVIRCDQPRAL
DLRARSGRRLEQVPPVIMDEVLARLATIFS
MRRGDIYLVTLDPTEGHEQQGTRPVLVISPDEFNRVTQVPVVLPITSGGNFARTAGFAVSLSGCGTRTTGVIRCDQPRAL
DLRARSGRRLEQVPPVIMDEVLARLATIFS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|