Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TacT2-ataR/DUF1778(antitoxin) |
Location | 994755..995526 | Replicon | chromosome |
Accession | NZ_LT630450 | ||
Organism | Desulfovibrio piger strain FI11049 isolate FI11049 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1K1LDK2 |
Locus tag | DESPIGER_RS04715 | Protein ID | WP_072333712.1 |
Coordinates | 994755..995255 (-) | Length | 167 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A1K1LDM7 |
Locus tag | DESPIGER_RS04720 | Protein ID | WP_072333715.1 |
Coordinates | 995257..995526 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DESPIGER_RS12625 | 990232..992427 | + | 2196 | WP_083575304.1 | SDR family NAD(P)-dependent oxidoreductase | - |
DESPIGER_RS04710 | 992417..993964 | + | 1548 | WP_072333709.1 | sulfatase-like hydrolase/transferase | - |
DESPIGER_RS12880 | 994207..994614 | + | 408 | WP_156831637.1 | helix-turn-helix domain-containing protein | - |
DESPIGER_RS04715 | 994755..995255 | - | 501 | WP_072333712.1 | GNAT family N-acetyltransferase | Toxin |
DESPIGER_RS04720 | 995257..995526 | - | 270 | WP_072333715.1 | DUF1778 domain-containing protein | Antitoxin |
DESPIGER_RS04725 | 995655..995924 | - | 270 | WP_072333718.1 | hypothetical protein | - |
DESPIGER_RS04730 | 995928..996128 | - | 201 | WP_072333720.1 | hypothetical protein | - |
DESPIGER_RS13080 | 996984..997247 | - | 264 | WP_162273851.1 | hypothetical protein | - |
DESPIGER_RS04735 | 997585..1000053 | + | 2469 | WP_072333723.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 977464..1003604 | 26140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 167 a.a. Molecular weight: 18135.16 Da Isoelectric Point: 10.1489
>T293398 WP_072333712.1 NZ_LT630450:c995255-994755 [Desulfovibrio piger]
MKISAPCHLEAHHHLESFCCGESLLDTWLKTRARKNEASGASRTYVITRSNDVIGYYSLAVGSVSHALVPGRIRRNMPDP
IPVMLLARLAVDTSLQGQGIGRALLRDAILRTEQAAHIAGIRAILVHALHERAKVFYKGCGFTPSPINELTLMLPLSVVR
ASMGSR
MKISAPCHLEAHHHLESFCCGESLLDTWLKTRARKNEASGASRTYVITRSNDVIGYYSLAVGSVSHALVPGRIRRNMPDP
IPVMLLARLAVDTSLQGQGIGRALLRDAILRTEQAAHIAGIRAILVHALHERAKVFYKGCGFTPSPINELTLMLPLSVVR
ASMGSR
Download Length: 501 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1K1LDK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1K1LDM7 |