Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
Location | 2497320..2497921 | Replicon | chromosome |
Accession | NZ_LT630287 | ||
Organism | Ligilactobacillus acidipiscis strain ACA-DC 1533 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | BQ5903_RS11585 | Protein ID | WP_056972590.1 |
Coordinates | 2497320..2497664 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | BQ5903_RS11590 | Protein ID | WP_056972592.1 |
Coordinates | 2497658..2497921 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BQ5903_RS11565 | 2492564..2494258 | + | 1695 | WP_079579603.1 | aryl-sulfate sulfotransferase | - |
BQ5903_RS11570 | 2494417..2495124 | + | 708 | WP_010495907.1 | glucosamine-6-phosphate deaminase | - |
BQ5903_RS11575 | 2495729..2496622 | - | 894 | WP_079578748.1 | IS982 family transposase | - |
BQ5903_RS11580 | 2496730..2497176 | + | 447 | Protein_2231 | helicase | - |
BQ5903_RS11585 | 2497320..2497664 | - | 345 | WP_056972590.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
BQ5903_RS11590 | 2497658..2497921 | - | 264 | WP_056972592.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
BQ5903_RS11595 | 2498017..2498604 | + | 588 | WP_079579604.1 | site-specific integrase | - |
BQ5903_RS11600 | 2498617..2498976 | + | 360 | WP_056972596.1 | hypothetical protein | - |
BQ5903_RS11605 | 2499102..2500487 | - | 1386 | WP_079579685.1 | group II intron reverse transcriptase/maturase | - |
BQ5903_RS11610 | 2500987..2502117 | - | 1131 | WP_079579605.1 | NAD(P)-dependent alcohol dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13111.00 Da Isoelectric Point: 6.8698
>T293395 WP_056972590.1 NZ_LT630287:c2497664-2497320 [Ligilactobacillus acidipiscis]
MVSQGDIFYVNFNPRRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
MVSQGDIFYVNFNPRRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|