Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3036719..3037373 | Replicon | chromosome |
| Accession | NZ_LT615378 | ||
| Organism | Escherichia coli isolate 103 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | BV310_RS16095 | Protein ID | WP_000244777.1 |
| Coordinates | 3036719..3037126 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | BV310_RS16100 | Protein ID | WP_000354046.1 |
| Coordinates | 3037107..3037373 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BV310_RS16075 | 3032676..3034409 | - | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| BV310_RS16080 | 3034415..3035125 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| BV310_RS16085 | 3035150..3036046 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| BV310_RS16090 | 3036158..3036679 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| BV310_RS16095 | 3036719..3037126 | - | 408 | WP_000244777.1 | toxin CptA | Toxin |
| BV310_RS16100 | 3037107..3037373 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| BV310_RS16105 | 3037616..3038596 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| BV310_RS16110 | 3038792..3039451 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| BV310_RS16115 | 3039615..3039926 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| BV310_RS16120 | 3039971..3041404 | + | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
| BV310_RS16125 | 3041461..3042204 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T293384 WP_000244777.1 NZ_LT615378:c3037126-3036719 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |