Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2080048..2080879 | Replicon | chromosome |
| Accession | NZ_LT615378 | ||
| Organism | Escherichia coli isolate 103 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | BV310_RS11310 | Protein ID | WP_000854814.1 |
| Coordinates | 2080505..2080879 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | BV310_RS11305 | Protein ID | WP_001285584.1 |
| Coordinates | 2080048..2080416 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BV310_RS11290 | 2077715..2079247 | + | 1533 | WP_001350525.1 | hypothetical protein | - |
| BV310_RS11295 | 2079244..2079690 | + | 447 | WP_000187523.1 | RadC family protein | - |
| BV310_RS11300 | 2079753..2079974 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| BV310_RS11305 | 2080048..2080416 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
| BV310_RS11310 | 2080505..2080879 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
| BV310_RS11315 | 2080876..2081070 | + | 195 | WP_000988600.1 | hypothetical protein | - |
| BV310_RS25160 | 2081083..2081196 | + | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| BV310_RS11325 | 2081485..2081613 | - | 129 | Protein_2019 | transposase domain-containing protein | - |
| BV310_RS11330 | 2081685..2081867 | + | 183 | WP_001016348.1 | hypothetical protein | - |
| BV310_RS11335 | 2081968..2082297 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| BV310_RS11340 | 2082469..2083527 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
| BV310_RS11345 | 2083725..2084198 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| BV310_RS11350 | 2084317..2085483 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T293379 WP_000854814.1 NZ_LT615378:2080505-2080879 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT293379 WP_001285584.1 NZ_LT615378:2080048-2080416 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |