Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 2773419..2774086 | Replicon | chromosome |
| Accession | NZ_LT615377 | ||
| Organism | Escherichia coli isolate 106 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | Q46953 |
| Locus tag | BV315_RS14785 | Protein ID | WP_001094400.1 |
| Coordinates | 2773757..2774086 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | P52141 |
| Locus tag | BV315_RS14780 | Protein ID | WP_000072690.1 |
| Coordinates | 2773419..2773736 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BV315_RS14750 | 2768471..2769480 | - | 1010 | Protein_2648 | arsenic transporter | - |
| BV315_RS14755 | 2769622..2771325 | + | 1704 | WP_001698958.1 | hypothetical protein | - |
| BV315_RS14760 | 2771897..2772120 | + | 224 | Protein_2650 | DUF905 family protein | - |
| BV315_RS14765 | 2772223..2772681 | + | 459 | WP_000211841.1 | antirestriction protein | - |
| BV315_RS14770 | 2772690..2773172 | + | 483 | WP_001407480.1 | RadC family protein | - |
| BV315_RS14775 | 2773181..2773381 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
| BV315_RS14780 | 2773419..2773736 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| BV315_RS14785 | 2773757..2774086 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
| BV315_RS14790 | 2774450..2779030 | - | 4581 | WP_010723187.1 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T293351 WP_001094400.1 NZ_LT615377:2773757-2774086 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A373F4I3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2EA9 | |
| PDB | 2JN7 | |
| AlphaFold DB | P52141 |