Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yafW-ykfI/CbtA-CbeA
Location 262720..263399 Replicon chromosome
Accession NZ_LT615377
Organism Escherichia coli isolate 106

Toxin (Protein)


Gene name ykfI Uniprot ID P77692
Locus tag BV315_RS01320 Protein ID WP_000854672.1
Coordinates 262720..263061 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yafW Uniprot ID Q47684
Locus tag BV315_RS01325 Protein ID WP_000070395.1
Coordinates 263082..263399 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BV315_RS01295 257997..258398 + 402 WP_000174689.1 sigma factor-binding protein Crl -
BV315_RS01300 258437..259492 - 1056 WP_000749863.1 phosphoporin PhoE -
BV315_RS01305 259780..260883 + 1104 WP_001285288.1 glutamate 5-kinase -
BV315_RS01310 260895..262148 + 1254 WP_000893278.1 glutamate-5-semialdehyde dehydrogenase -
BV315_RS01320 262720..263061 - 342 WP_000854672.1 type IV toxin-antitoxin system toxin YkfI Toxin
BV315_RS01325 263082..263399 - 318 WP_000070395.1 type IV toxin-antitoxin system antitoxin YafW Antitoxin
BV315_RS01330 263418..263639 - 222 WP_000691994.1 DUF987 domain-containing protein -
BV315_RS01335 263648..264124 - 477 WP_000811693.1 RadC family protein -
BV315_RS01340 264140..264598 - 459 WP_000211838.1 antirestriction protein -
BV315_RS01345 264696..264935 - 240 WP_000194654.1 DUF905 domain-containing protein -
BV315_RS01350 265012..265479 - 468 WP_001547765.1 hypothetical protein -
BV315_RS24920 265502..265945 - 444 WP_000824223.1 hypothetical protein -
BV315_RS24925 265945..266172 - 228 WP_001548158.1 hypothetical protein -
BV315_RS24930 266168..266359 - 192 Protein_250 DeoR family transcriptional regulator -
BV315_RS01365 266576..267397 - 822 WP_000197389.1 DUF945 domain-containing protein -
BV315_RS01370 267489..268352 - 864 WP_001065553.1 GTPase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(6-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12905.01 Da        Isoelectric Point: 9.6543

>T293336 WP_000854672.1 NZ_LT615377:c263061-262720 [Escherichia coli]
MKTLPAITQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11939.59 Da        Isoelectric Point: 6.7391

>AT293336 WP_000070395.1 NZ_LT615377:c263399-263082 [Escherichia coli]
MSNPTRGLQREITLRLGARLVQEGNRLHYLADRASITGKFSDIECRKLDETFPHFILQMESMLTTGELSPHHAHCVTLYH
NDLTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P77692

Antitoxin

Source ID Structure
AlphaFold DB Q47684

References