Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3365364..3366148 | Replicon | chromosome |
Accession | NZ_LT615367 | ||
Organism | Dickeya aquatica strain 174/2 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | DAQ1742_RS15345 | Protein ID | WP_071604060.1 |
Coordinates | 3365364..3365858 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A375ADW5 |
Locus tag | DAQ1742_RS15350 | Protein ID | WP_035340289.1 |
Coordinates | 3365855..3366148 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DAQ1742_RS15330 | 3361713..3363866 | - | 2154 | WP_067486626.1 | ornithine decarboxylase | - |
DAQ1742_RS15340 | 3364649..3365266 | + | 618 | Protein_2986 | IS256 family transposase | - |
DAQ1742_RS15345 | 3365364..3365858 | - | 495 | WP_071604060.1 | GNAT family N-acetyltransferase | Toxin |
DAQ1742_RS15350 | 3365855..3366148 | - | 294 | WP_035340289.1 | DUF1778 domain-containing protein | Antitoxin |
DAQ1742_RS15355 | 3367616..3368281 | + | 666 | WP_035340287.1 | HAD-IB family hydrolase | - |
DAQ1742_RS15360 | 3368642..3369217 | - | 576 | WP_035340285.1 | TerD family protein | - |
DAQ1742_RS15365 | 3369303..3369881 | - | 579 | WP_035340283.1 | TerD family protein | - |
DAQ1742_RS15370 | 3369934..3370977 | - | 1044 | WP_035340281.1 | TerC/Alx family metal homeostasis membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 17620.53 Da Isoelectric Point: 7.8046
>T293332 WP_071604060.1 NZ_LT615367:c3365858-3365364 [Dickeya aquatica]
MISAPEPLHAEHVLSSFCCGVESMDNWLKLRAMKNQVTGASRTFVSCDGSKVLAYYSLASSAVATNVAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVADTIGIRGMLVHALSDEAREFYLRVGFEPSPIDPMILMVTLGDLVG
SLSI
MISAPEPLHAEHVLSSFCCGVESMDNWLKLRAMKNQVTGASRTFVSCDGSKVLAYYSLASSAVATNVAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVADTIGIRGMLVHALSDEAREFYLRVGFEPSPIDPMILMVTLGDLVG
SLSI
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|