Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3153273..3153897 | Replicon | chromosome |
| Accession | NZ_LT615367 | ||
| Organism | Dickeya aquatica strain 174/2 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | E0SD87 |
| Locus tag | DAQ1742_RS14245 | Protein ID | WP_009114000.1 |
| Coordinates | 3153694..3153897 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | DAQ1742_RS14240 | Protein ID | WP_035340556.1 |
| Coordinates | 3153273..3153641 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DAQ1742_RS14225 | 3149066..3152218 | + | 3153 | WP_035340560.1 | multidrug efflux RND transporter permease subunit | - |
| DAQ1742_RS14230 | 3152379..3152630 | + | 252 | WP_035340558.1 | type B 50S ribosomal protein L31 | - |
| DAQ1742_RS14235 | 3152646..3152789 | + | 144 | WP_071604062.1 | type B 50S ribosomal protein L36 | - |
| DAQ1742_RS14240 | 3153273..3153641 | + | 369 | WP_035340556.1 | Hha toxicity modulator TomB | Antitoxin |
| DAQ1742_RS14245 | 3153694..3153897 | + | 204 | WP_009114000.1 | hemolysin expression modulator Hha | Toxin |
| DAQ1742_RS14255 | 3154568..3154891 | + | 324 | WP_035345804.1 | MGMT family protein | - |
| DAQ1742_RS14260 | 3154949..3155509 | - | 561 | WP_035340554.1 | YbaY family lipoprotein | - |
| DAQ1742_RS14265 | 3155755..3156618 | + | 864 | WP_035340553.1 | acyl-CoA thioesterase II | - |
| DAQ1742_RS14270 | 3156775..3158067 | - | 1293 | WP_035340550.1 | ammonium transporter AmtB | - |
| DAQ1742_RS14275 | 3158111..3158449 | - | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8133.51 Da Isoelectric Point: 8.8500
>T293331 WP_009114000.1 NZ_LT615367:3153694-3153897 [Dickeya aquatica]
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWKYVR
MKKIDYLMRLRKCTTIDTLERVIEKNKYELSNDELEMFYSAADHRLAELTMNKLYDKVPTAVWKYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14209.98 Da Isoelectric Point: 4.9037
>AT293331 WP_035340556.1 NZ_LT615367:3153273-3153641 [Dickeya aquatica]
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSHGWVNDPTSAVNLQLNELIEHIAAFVVTYKIKYPHESGLCERVEKYL
DDTYILFSNYGINDTELQKWQKSKSQLFRMFSEKNVCTVVKT
MDEYTPQHYDIAQLRFLCENLHDESIATLGDSSHGWVNDPTSAVNLQLNELIEHIAAFVVTYKIKYPHESGLCERVEKYL
DDTYILFSNYGINDTELQKWQKSKSQLFRMFSEKNVCTVVKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|