Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 1498816..1499369 | Replicon | chromosome |
Accession | NZ_LT615367 | ||
Organism | Dickeya aquatica strain 174/2 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | DAQ1742_RS06670 | Protein ID | WP_035342967.1 |
Coordinates | 1498816..1499130 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A375A8K7 |
Locus tag | DAQ1742_RS06675 | Protein ID | WP_035342965.1 |
Coordinates | 1499133..1499369 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DAQ1742_RS06660 | 1497808..1498023 | - | 216 | Protein_1279 | transposase | - |
DAQ1742_RS06665 | 1498195..1498491 | - | 297 | WP_067487160.1 | hypothetical protein | - |
DAQ1742_RS06670 | 1498816..1499130 | - | 315 | WP_035342967.1 | CcdB family protein | Toxin |
DAQ1742_RS06675 | 1499133..1499369 | - | 237 | WP_035342965.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
DAQ1742_RS06680 | 1499730..1500296 | - | 567 | WP_180706259.1 | DDE-type integrase/transposase/recombinase | - |
DAQ1742_RS06685 | 1500257..1500652 | - | 396 | WP_145916196.1 | transposase | - |
DAQ1742_RS06690 | 1500733..1501865 | + | 1133 | WP_145916195.1 | IS3 family transposase | - |
DAQ1742_RS06695 | 1501883..1502764 | - | 882 | Protein_1286 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11493.40 Da Isoelectric Point: 7.9859
>T293326 WP_035342967.1 NZ_LT615367:c1499130-1498816 [Dickeya aquatica]
MQFTVYGNTGKSAVYPLLLDVTSDIIGQLNRRIVIPLLPVEKYPAGRRPDRLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRTQVKAAIDFLIDGF
MQFTVYGNTGKSAVYPLLLDVTSDIIGQLNRRIVIPLLPVEKYPAGRRPDRLVPVVRLTDGKEYAVMTHELASIPVQALG
AVFCDASQYRTQVKAAIDFLIDGF
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|