Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 741293..741971 | Replicon | chromosome |
| Accession | NZ_LT615367 | ||
| Organism | Dickeya aquatica strain 174/2 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | DAQ1742_RS03400 | Protein ID | WP_035339869.1 |
| Coordinates | 741540..741971 (+) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A375A716 |
| Locus tag | DAQ1742_RS03395 | Protein ID | WP_035339867.1 |
| Coordinates | 741293..741559 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DAQ1742_RS03375 | 737713..738354 | + | 642 | WP_035339858.1 | LysE family translocator | - |
| DAQ1742_RS03380 | 738426..739034 | - | 609 | WP_035339860.1 | HD domain-containing protein | - |
| DAQ1742_RS03385 | 739241..739891 | + | 651 | WP_035339863.1 | hemolysin III family protein | - |
| DAQ1742_RS03390 | 739994..740974 | - | 981 | WP_035339865.1 | tRNA-modifying protein YgfZ | - |
| DAQ1742_RS03395 | 741293..741559 | + | 267 | WP_035339867.1 | FAD assembly factor SdhE | Antitoxin |
| DAQ1742_RS03400 | 741540..741971 | + | 432 | WP_035339869.1 | protein YgfX | Toxin |
| DAQ1742_RS03405 | 742038..742556 | - | 519 | WP_035339871.1 | flavodoxin FldB | - |
| DAQ1742_RS03410 | 742664..743989 | - | 1326 | WP_035345729.1 | MHS family MFS transporter | - |
| DAQ1742_RS03415 | 744252..745151 | + | 900 | WP_035339873.1 | site-specific tyrosine recombinase XerD | - |
| DAQ1742_RS03420 | 745240..745971 | + | 732 | WP_035339875.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 16693.63 Da Isoelectric Point: 12.0401
>T293325 WP_035339869.1 NZ_LT615367:741540-741971 [Dickeya aquatica]
VALWQCDLRVSWRMQLFSLMMHGLLVLMILLAPWPDGYAPLWLGLVTLVVFGFVRSQRVIKSRQGEISLHDENRLHWQQR
DWLIVRRPWMLRSGILLSLRAANGKGRQHLWLASDSMGNAEWRRLRQLLQHPALSGAESSRHP
VALWQCDLRVSWRMQLFSLMMHGLLVLMILLAPWPDGYAPLWLGLVTLVVFGFVRSQRVIKSRQGEISLHDENRLHWQQR
DWLIVRRPWMLRSGILLSLRAANGKGRQHLWLASDSMGNAEWRRLRQLLQHPALSGAESSRHP
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|