Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-sanaA/DUF6088(antitoxin) |
| Location | 528446..529153 | Replicon | chromosome |
| Accession | NZ_LT615367 | ||
| Organism | Dickeya aquatica strain 174/2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D2C2R7 |
| Locus tag | DAQ1742_RS02410 | Protein ID | WP_012883161.1 |
| Coordinates | 528446..528721 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | sanaA | Uniprot ID | - |
| Locus tag | DAQ1742_RS02415 | Protein ID | WP_035339559.1 |
| Coordinates | 528758..529153 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DAQ1742_RS02370 | 524000..524710 | + | 711 | WP_035339553.1 | transcriptional regulator | - |
| DAQ1742_RS02375 | 524778..525344 | + | 567 | WP_035339554.1 | hypothetical protein | - |
| DAQ1742_RS02380 | 525373..525840 | + | 468 | WP_051123993.1 | hypothetical protein | - |
| DAQ1742_RS02385 | 525914..526387 | + | 474 | WP_035339555.1 | DNA repair protein RadC | - |
| DAQ1742_RS02390 | 526432..526788 | + | 357 | WP_035345683.1 | type IV toxin-antitoxin system YeeU family antitoxin | - |
| DAQ1742_RS02395 | 526814..527134 | + | 321 | WP_180706221.1 | TA system toxin CbtA family protein | - |
| DAQ1742_RS02400 | 527250..528083 | + | 834 | WP_180706222.1 | DUF4942 domain-containing protein | - |
| DAQ1742_RS02405 | 528194..528442 | + | 249 | WP_012883160.1 | ribbon-helix-helix domain-containing protein | - |
| DAQ1742_RS02410 | 528446..528721 | + | 276 | WP_012883161.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DAQ1742_RS02415 | 528758..529153 | + | 396 | WP_035339559.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | Antitoxin |
| DAQ1742_RS02420 | 529719..530741 | + | 1023 | WP_027711197.1 | IS110 family transposase | - |
| DAQ1742_RS02425 | 531022..531423 | + | 402 | WP_035345685.1 | membrane lipoprotein lipid attachment site-containing protein | - |
| DAQ1742_RS02430 | 531628..531996 | - | 369 | WP_051123995.1 | hypothetical protein | - |
| DAQ1742_RS02435 | 532699..533502 | + | 804 | WP_035339560.1 | hypothetical protein | - |
| DAQ1742_RS02440 | 533523..534149 | - | 627 | WP_035339561.1 | LysE/ArgO family amino acid transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 11194.47 Da Isoelectric Point: 5.1487
>T293324 WP_012883161.1 NZ_LT615367:528446-528721 [Dickeya aquatica]
MEILWTQKAQDDLERIYRFASQYSRQHADDVLDRLFIGTTELVDHPRIGVSQTRYEPREVRKILFDDYEVHYEIQHNTIY
IVDLWHTREDR
MEILWTQKAQDDLERIYRFASQYSRQHADDVLDRLFIGTTELVDHPRIGVSQTRYEPREVRKILFDDYEVHYEIQHNTIY
IVDLWHTREDR
Download Length: 276 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14267.41 Da Isoelectric Point: 10.3524
>AT293324 WP_035339559.1 NZ_LT615367:528758-529153 [Dickeya aquatica]
MTMRDRIQSRLKSSTRYVFTRDDFKDIGSYAQVGKVLRNLVSEGVLLKVGYGVYTKARQNSITGNIMPSAPGGSSAVIIE
TLECLNVPYRFVGATAAYNSGKSTQIPVSLEIETPLSFKRVLSVGNSKLNA
MTMRDRIQSRLKSSTRYVFTRDDFKDIGSYAQVGKVLRNLVSEGVLLKVGYGVYTKARQNSITGNIMPSAPGGSSAVIIE
TLECLNVPYRFVGATAAYNSGKSTQIPVSLEIETPLSFKRVLSVGNSKLNA
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|