Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yeeU/CbtA-CbeA
Location 526432..527134 Replicon chromosome
Accession NZ_LT615367
Organism Dickeya aquatica strain 174/2

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag DAQ1742_RS02395 Protein ID WP_180706221.1
Coordinates 526814..527134 (+) Length 107 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag DAQ1742_RS02390 Protein ID WP_035345683.1
Coordinates 526432..526788 (+) Length 119 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DAQ1742_RS02360 522008..522874 + 867 WP_180706219.1 GTPase family protein -
DAQ1742_RS02365 522965..523798 + 834 WP_180706220.1 DUF945 domain-containing protein -
DAQ1742_RS02370 524000..524710 + 711 WP_035339553.1 transcriptional regulator -
DAQ1742_RS02375 524778..525344 + 567 WP_035339554.1 hypothetical protein -
DAQ1742_RS02380 525373..525840 + 468 WP_051123993.1 hypothetical protein -
DAQ1742_RS02385 525914..526387 + 474 WP_035339555.1 DNA repair protein RadC -
DAQ1742_RS02390 526432..526788 + 357 WP_035345683.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
DAQ1742_RS02395 526814..527134 + 321 WP_180706221.1 TA system toxin CbtA family protein Toxin
DAQ1742_RS02400 527250..528083 + 834 WP_180706222.1 DUF4942 domain-containing protein -
DAQ1742_RS02405 528194..528442 + 249 WP_012883160.1 ribbon-helix-helix domain-containing protein -
DAQ1742_RS02410 528446..528721 + 276 WP_012883161.1 type II toxin-antitoxin system RelE/ParE family toxin -
DAQ1742_RS02415 528758..529153 + 396 WP_035339559.1 type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein -
DAQ1742_RS02420 529719..530741 + 1023 WP_027711197.1 IS110 family transposase -
DAQ1742_RS02425 531022..531423 + 402 WP_035345685.1 membrane lipoprotein lipid attachment site-containing protein -
DAQ1742_RS02430 531628..531996 - 369 WP_051123995.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(7-105)

Antitoxin

Antitoxin CbeA

(7-106)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 11956.59 Da        Isoelectric Point: 4.8046

>T293322 WP_180706221.1 NZ_LT615367:526814-527134 [Dickeya aquatica]
METPSPSPAREASSCLSPVNVWQQLLTYLLDKHYGLTLNDTPFCEEAEIQAHLDAGVSLPDAVNFLVERYELVRIDRSGF
SWQEQKPFLNAVDILRARRATGLLKP

Download         Length: 321 bp

Antitoxin


Download         Length: 119 a.a.        Molecular weight: 12967.81 Da        Isoelectric Point: 6.4789

>AT293322 WP_035345683.1 NZ_LT615367:526432-526788 [Dickeya aquatica]
MSLSDAPEWGLEHTLKPRFGARLVQEGCHLHFLADRAGVTGTFSATVACHLEHRFPLMVKQLEQKLVTGELDPYRQQRVT
LHDGILTCEADTLGSAGYVYITIYPTTVATPATAFPSP

Download         Length: 357 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References