Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-higA/HigB-HigA |
| Location | 1796303..1796997 | Replicon | chromosome |
| Accession | NZ_LT615228 | ||
| Organism | Polynucleobacter necessarius isolate PPGSP1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | DXE33_RS09405 | Protein ID | WP_114639796.1 |
| Coordinates | 1796710..1796997 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | DXE33_RS09400 | Protein ID | WP_114639633.1 |
| Coordinates | 1796303..1796713 (-) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE33_RS09370 | 1791482..1792255 | - | 774 | WP_114639627.1 | 3-deoxy-manno-octulosonate cytidylyltransferase | - |
| DXE33_RS09375 | 1792280..1792459 | - | 180 | WP_114639628.1 | Trm112 family protein | - |
| DXE33_RS09380 | 1792527..1793621 | - | 1095 | WP_114639629.1 | tetraacyldisaccharide 4'-kinase | - |
| DXE33_RS09385 | 1793639..1794088 | - | 450 | WP_114639630.1 | biopolymer transporter ExbD | - |
| DXE33_RS09390 | 1794085..1794723 | - | 639 | WP_114639631.1 | MotA/TolQ/ExbB proton channel family protein | - |
| DXE33_RS09395 | 1795051..1796259 | + | 1209 | WP_114639632.1 | exodeoxyribonuclease VII large subunit | - |
| DXE33_RS09400 | 1796303..1796713 | - | 411 | WP_114639633.1 | transcriptional regulator | Antitoxin |
| DXE33_RS09405 | 1796710..1796997 | - | 288 | WP_114639796.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| DXE33_RS09410 | 1797080..1798117 | - | 1038 | WP_114639634.1 | UDP-N-acetylmuramate dehydrogenase | - |
| DXE33_RS09415 | 1798235..1798720 | + | 486 | WP_114639635.1 | YajQ family cyclic di-GMP-binding protein | - |
| DXE33_RS09420 | 1798713..1799660 | + | 948 | WP_114639636.1 | site-specific tyrosine recombinase XerD | - |
| DXE33_RS09425 | 1799713..1800345 | + | 633 | WP_114639637.1 | glycerol-3-phosphate 1-O-acyltransferase PlsY | - |
| DXE33_RS09430 | 1800390..1800761 | + | 372 | WP_114639638.1 | MAPEG family protein | - |
| DXE33_RS09435 | 1800852..1801658 | + | 807 | WP_114639639.1 | GTP cyclohydrolase I | - |
| DXE33_RS09440 | 1801764..1801982 | + | 219 | WP_114639640.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11265.19 Da Isoelectric Point: 10.5034
>T293321 WP_114639796.1 NZ_LT615228:c1796997-1796710 [Polynucleobacter necessarius]
MRVITNRRLLEFAASHKDASAPLQAWRKLMKFGSYANFADIRQVFRAVDKVGDLYVFNICGNKYRLITFLQFERQLCYIK
AVLTHKQYDKDGWKK
MRVITNRRLLEFAASHKDASAPLQAWRKLMKFGSYANFADIRQVFRAVDKVGDLYVFNICGNKYRLITFLQFERQLCYIK
AVLTHKQYDKDGWKK
Download Length: 288 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15581.92 Da Isoelectric Point: 7.3170
>AT293321 WP_114639633.1 NZ_LT615228:c1796713-1796303 [Polynucleobacter necessarius]
MNLNDLKKAWENLAKTVDLSPIRNERQYKKMVQLADMLSEVVASSKKHPLLDLFELVSELIRTYEYEHFPSPDAKPQAVL
AYLMEQHQLRQSDLPEVGNQSVISQILSGARELNVRQINALARRFKIPAGVFFESS
MNLNDLKKAWENLAKTVDLSPIRNERQYKKMVQLADMLSEVVASSKKHPLLDLFELVSELIRTYEYEHFPSPDAKPQAVL
AYLMEQHQLRQSDLPEVGNQSVISQILSGARELNVRQINALARRFKIPAGVFFESS
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|