Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 887208..887839 | Replicon | chromosome |
Accession | NZ_LT615228 | ||
Organism | Polynucleobacter necessarius isolate PPGSP1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | DXE33_RS04600 | Protein ID | WP_114638852.1 |
Coordinates | 887208..887606 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | DXE33_RS04605 | Protein ID | WP_068323602.1 |
Coordinates | 887606..887839 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE33_RS04585 | 883122..883805 | - | 684 | WP_114638846.1 | outer membrane lipoprotein carrier protein LolA | - |
DXE33_RS04590 | 883815..886127 | - | 2313 | WP_114638848.1 | DNA translocase FtsK | - |
DXE33_RS04595 | 886167..887123 | + | 957 | WP_114638850.1 | thioredoxin-disulfide reductase | - |
DXE33_RS04600 | 887208..887606 | - | 399 | WP_114638852.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
DXE33_RS04605 | 887606..887839 | - | 234 | WP_068323602.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
DXE33_RS04610 | 888194..890254 | - | 2061 | Protein_913 | sodium-translocating pyrophosphatase | - |
DXE33_RS04615 | 890439..890975 | + | 537 | WP_114638854.1 | inorganic diphosphatase | - |
DXE33_RS04620 | 891004..892623 | + | 1620 | WP_114638856.1 | NAD+ synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14999.35 Da Isoelectric Point: 7.4626
>T293320 WP_114638852.1 NZ_LT615228:c887606-887208 [Polynucleobacter necessarius]
MLKYLLDTNIVIYVMKRKPLEVLKVFNKNANRMAISTITLAELMYGAEKSQQVESNLNNIEDFVSHLEVLPYDIYATQHY
GQIKAFLESTGKPIGVNDIHIAAHARSHGLTLVTNNLSEFKRVPNLALENWV
MLKYLLDTNIVIYVMKRKPLEVLKVFNKNANRMAISTITLAELMYGAEKSQQVESNLNNIEDFVSHLEVLPYDIYATQHY
GQIKAFLESTGKPIGVNDIHIAAHARSHGLTLVTNNLSEFKRVPNLALENWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|