Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2087538..2088067 | Replicon | chromosome |
| Accession | NZ_LT615218 | ||
| Organism | Staphylococcus aureus strain AUS0325 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | BQ3358_RS10620 | Protein ID | WP_000621177.1 |
| Coordinates | 2087538..2087900 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | BQ3358_RS10625 | Protein ID | WP_000948331.1 |
| Coordinates | 2087897..2088067 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BQ3358_RS10595 | 2084516..2085286 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| BQ3358_RS10600 | 2085261..2085740 | - | 480 | WP_001190829.1 | anti-sigma B factor RsbW | - |
| BQ3358_RS10605 | 2085742..2086068 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| BQ3358_RS10610 | 2086187..2087188 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| BQ3358_RS10620 | 2087538..2087900 | - | 363 | WP_000621177.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| BQ3358_RS10625 | 2087897..2088067 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| BQ3358_RS10630 | 2088152..2089300 | - | 1149 | WP_001281147.1 | alanine racemase | - |
| BQ3358_RS10635 | 2089366..2089725 | - | 360 | WP_000581202.1 | holo-ACP synthase | - |
| BQ3358_RS10640 | 2089729..2090220 | - | 492 | WP_001205910.1 | PH domain-containing protein | - |
| BQ3358_RS10645 | 2090207..2091789 | - | 1583 | Protein_2011 | PH domain-containing protein | - |
| BQ3358_RS10650 | 2091782..2092261 | - | 480 | WP_001287078.1 | hypothetical protein | - |
| BQ3358_RS10655 | 2092470..2093030 | - | 561 | WP_001092409.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13471.72 Da Isoelectric Point: 10.1654
>T293313 WP_000621177.1 NZ_LT615218:c2087900-2087538 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNTVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNTVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|