Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 861491..861968 Replicon chromosome
Accession NZ_LT615218
Organism Staphylococcus aureus strain AUS0325

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag BQ3358_RS04295 Protein ID WP_000052076.1
Coordinates 861491..861679 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag BQ3358_RS04300 Protein ID WP_001059690.1
Coordinates 861708..861968 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BQ3358_RS04265 857485..858006 + 522 WP_000824482.1 hypothetical protein -
BQ3358_RS04270 858347..859033 + 687 WP_000141557.1 thermonuclease family protein -
BQ3358_RS04275 859390..859590 + 201 WP_001059082.1 cold-shock protein -
BQ3358_RS04280 860082..860300 - 219 WP_000005886.1 hypothetical protein -
BQ3358_RS04285 860362..860646 - 285 WP_001004399.1 hypothetical protein -
BQ3358_RS04290 860734..861303 - 570 WP_001106654.1 hypothetical protein -
BQ3358_RS04295 861491..861679 - 189 WP_000052076.1 hypothetical protein Toxin
BQ3358_RS04300 861708..861968 - 261 WP_001059690.1 hypothetical protein Antitoxin
BQ3358_RS04305 862309..862512 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
BQ3358_RS04310 862509..862745 - 237 WP_000349581.1 hypothetical protein -
BQ3358_RS04315 862970..863551 + 582 WP_001140693.1 phosphoglycerate mutase family protein -
BQ3358_RS04320 863624..864241 - 618 WP_069991886.1 LysE/ArgO family amino acid transporter -
BQ3358_RS04325 864396..864890 - 495 WP_000569884.1 GNAT family N-acetyltransferase -
BQ3358_RS04330 865288..865710 - 423 WP_000974460.1 organic hydroperoxide resistance protein -
BQ3358_RS04335 865858..866574 + 717 WP_000150011.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp 791361..864890 73529
- inside Prophage - vWbp 791361..865710 74349


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T293307 WP_000052076.1 NZ_LT615218:c861679-861491 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT293307 WP_001059690.1 NZ_LT615218:c861968-861708 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References