Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 141482..141987 | Replicon | chromosome |
Accession | NZ_LT608330 | ||
Organism | Pseudomonas aeruginosa isolate PA14Or_reads |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | PHAGEPCYII10_RS00630 | Protein ID | WP_003083773.1 |
Coordinates | 141482..141763 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A0H2ZJU8 |
Locus tag | PHAGEPCYII10_RS00635 | Protein ID | WP_003137009.1 |
Coordinates | 141760..141987 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHAGEPCYII10_RS00605 | 136733..138082 | + | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
PHAGEPCYII10_RS00610 | 138131..138817 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
PHAGEPCYII10_RS00615 | 138918..139652 | + | 735 | WP_003110658.1 | GntR family transcriptional regulator | - |
PHAGEPCYII10_RS00620 | 139856..140242 | + | 387 | WP_003083767.1 | aegerolysin family protein | - |
PHAGEPCYII10_RS00625 | 140274..141182 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
PHAGEPCYII10_RS00630 | 141482..141763 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PHAGEPCYII10_RS00635 | 141760..141987 | - | 228 | WP_003137009.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PHAGEPCYII10_RS00640 | 142163..142786 | - | 624 | WP_003137011.1 | hypothetical protein | - |
PHAGEPCYII10_RS00645 | 142887..143387 | + | 501 | WP_003137013.1 | LEA type 2 family protein | - |
PHAGEPCYII10_RS00650 | 143459..143800 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
PHAGEPCYII10_RS00655 | 143882..145309 | - | 1428 | WP_003137015.1 | GABA permease | - |
PHAGEPCYII10_RS00660 | 145478..146971 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T293300 WP_003083773.1 NZ_LT608330:c141763-141482 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|