Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1068063..1068709 | Replicon | chromosome |
Accession | NZ_LT606949 | ||
Organism | Polynucleobacter necessarius isolate PPGSP7 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | DXE35_RS05825 | Protein ID | WP_114689857.1 |
Coordinates | 1068063..1068476 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | DXE35_RS05830 | Protein ID | WP_114689858.1 |
Coordinates | 1068476..1068709 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE35_RS05810 | 1064014..1064697 | - | 684 | WP_114689854.1 | outer membrane lipoprotein carrier protein LolA | - |
DXE35_RS05815 | 1064704..1066941 | - | 2238 | WP_197714057.1 | DNA translocase FtsK | - |
DXE35_RS05820 | 1067055..1068011 | + | 957 | WP_114689856.1 | thioredoxin-disulfide reductase | - |
DXE35_RS05825 | 1068063..1068476 | - | 414 | WP_114689857.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
DXE35_RS05830 | 1068476..1068709 | - | 234 | WP_114689858.1 | antitoxin | Antitoxin |
DXE35_RS05835 | 1069049..1070895 | - | 1847 | Protein_1174 | sodium-translocating pyrophosphatase | - |
DXE35_RS05840 | 1071081..1071617 | + | 537 | WP_114689859.1 | inorganic diphosphatase | - |
DXE35_RS05845 | 1071653..1073272 | + | 1620 | Protein_1176 | NAD+ synthase | - |
DXE35_RS05850 | 1073345..1073683 | + | 339 | WP_114689860.1 | P-II family nitrogen regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15330.73 Da Isoelectric Point: 7.5189
>T293297 WP_114689857.1 NZ_LT606949:c1068476-1068063 [Polynucleobacter necessarius]
VLKYLLDTNIVIYVIKRKPLEALKVFNKNANRMAISAITLAELIYDAEKSAHVDKNLNVIEDFVSHLEGLPYDINATQHY
GQIKAFLERAGQPIGINDIHIAAHARSHGLTLVTNNMSEFKRVLNLALENWVAASLP
VLKYLLDTNIVIYVIKRKPLEALKVFNKNANRMAISAITLAELIYDAEKSAHVDKNLNVIEDFVSHLEGLPYDINATQHY
GQIKAFLERAGQPIGINDIHIAAHARSHGLTLVTNNMSEFKRVLNLALENWVAASLP
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|