Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 47432..48015 Replicon chromosome
Accession NZ_LT606949
Organism Polynucleobacter necessarius isolate PPGSP7

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag DXE35_RS00330 Protein ID WP_114689150.1
Coordinates 47821..48015 (-) Length 65 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag DXE35_RS00325 Protein ID WP_114689149.1
Coordinates 47432..47824 (-) Length 131 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE35_RS00300 43407..44474 - 1068 WP_114689144.1 histidinol-phosphate transaminase -
DXE35_RS00305 44591..45178 + 588 WP_114689145.1 imidazoleglycerol-phosphate dehydratase HisB -
DXE35_RS00310 45228..45884 + 657 WP_114689146.1 imidazole glycerol phosphate synthase subunit HisH -
DXE35_RS00315 45903..46664 + 762 WP_114689147.1 1-(5-phosphoribosyl)-5-[(5- phosphoribosylamino)methylideneamino]imidazole-4- carboxamide isomerase -
DXE35_RS00320 46664..47422 + 759 WP_114689148.1 imidazole glycerol phosphate synthase subunit HisF -
DXE35_RS00325 47432..47824 - 393 WP_114689149.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
DXE35_RS00330 47821..48015 - 195 WP_114689150.1 type II toxin-antitoxin system HicA family toxin Toxin
DXE35_RS00335 48142..48537 + 396 WP_114689151.1 phosphoribosyl-AMP cyclohydrolase -
DXE35_RS00340 48577..49011 + 435 WP_114689152.1 phosphoribosyl-ATP diphosphatase -
DXE35_RS00345 49014..49370 + 357 WP_114689153.1 histidine triad nucleotide-binding protein -
DXE35_RS00350 49387..49608 + 222 WP_114689154.1 Sec-independent protein translocase subunit TatA -
DXE35_RS00355 49675..50151 + 477 WP_114689155.1 Sec-independent protein translocase protein TatB -
DXE35_RS00360 50185..50964 + 780 WP_114689156.1 twin-arginine translocase subunit TatC -
DXE35_RS00365 50961..52424 - 1464 WP_114689157.1 sel1 repeat family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 65 a.a.        Molecular weight: 7020.37 Da        Isoelectric Point: 10.7976

>T293296 WP_114689150.1 NZ_LT606949:c48015-47821 [Polynucleobacter necessarius]
MNSKELIKALIKDGWVLRSSKGSHHVFNHLCKGGHITIPHPKKDVGIGVVQKLLKQADIKSGIL

Download         Length: 195 bp

Antitoxin


Download         Length: 131 a.a.        Molecular weight: 14081.08 Da        Isoelectric Point: 4.6190

>AT293296 WP_114689149.1 NZ_LT606949:c47824-47432 [Polynucleobacter necessarius]
MKYPIAIEPGSDKTAWGVIVPDLPGCFSAADSGIDEAIENAKEAIELWIETALDASQDIPKPSSITSLQKKKEFRGYVWA
IAEIDPALLSDDIERVNISLPKRVLARLDAKAKSAGENRSAFIAHMAIST

Download         Length: 393 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References