Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1181449..1182032 | Replicon | chromosome |
Accession | NZ_LT606946 | ||
Organism | Polynucleobacter necessarius isolate PPGSP5 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | DXE44_RS06130 | Protein ID | WP_114653504.1 |
Coordinates | 1181838..1182032 (-) | Length | 65 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | DXE44_RS06125 | Protein ID | WP_114653502.1 |
Coordinates | 1181449..1181841 (-) | Length | 131 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE44_RS06100 | 1177213..1178181 | + | 969 | WP_114653492.1 | tripartite tricarboxylate transporter substrate binding protein BugE | - |
DXE44_RS06105 | 1178323..1178604 | - | 282 | WP_162785890.1 | hypothetical protein | - |
DXE44_RS06110 | 1178615..1179148 | - | 534 | WP_162785891.1 | hypothetical protein | - |
DXE44_RS10100 | 1179325..1179675 | - | 351 | WP_162785892.1 | hypothetical protein | - |
DXE44_RS06115 | 1179868..1180245 | + | 378 | WP_114653498.1 | glycosyltransferase | - |
DXE44_RS06120 | 1180287..1181393 | + | 1107 | WP_114653499.1 | HAD-IB family phosphatase | - |
DXE44_RS06125 | 1181449..1181841 | - | 393 | WP_114653502.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
DXE44_RS06130 | 1181838..1182032 | - | 195 | WP_114653504.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
DXE44_RS06135 | 1182077..1184479 | - | 2403 | WP_162785920.1 | DNA internalization-related competence protein ComEC/Rec2 | - |
DXE44_RS06140 | 1184571..1185431 | - | 861 | WP_114653505.1 | TatD family hydrolase | - |
DXE44_RS06145 | 1185428..1186099 | - | 672 | WP_114654376.1 | ATP-binding cassette domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1177213..1191294 | 14081 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7299.58 Da Isoelectric Point: 10.8795
>T293295 WP_114653504.1 NZ_LT606946:c1182032-1181838 [Polynucleobacter necessarius]
MHSKKLIELLSSDGWVLSRTRGSHHIFTHRTKDGHICIPHPKKDLGLGLVEKILKQADIKRGHK
MHSKKLIELLSSDGWVLSRTRGSHHIFTHRTKDGHICIPHPKKDLGLGLVEKILKQADIKRGHK
Download Length: 195 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 14503.74 Da Isoelectric Point: 5.0435
>AT293295 WP_114653502.1 NZ_LT606946:c1181841-1181449 [Polynucleobacter necessarius]
MKYPIAIEPGSSKEAWGVVVPDLAGCFSAGDRDIDEAIENAKEAIEIWIELALERNQEIPKPSSLRELQKRKEFKGWVWA
IVEIDPALLSDEIERINITLPKRVLARLDAKAKKAGENRSAFIAHLALTA
MKYPIAIEPGSSKEAWGVVVPDLAGCFSAGDRDIDEAIENAKEAIEIWIELALERNQEIPKPSSLRELQKRKEFKGWVWA
IVEIDPALLSDEIERINITLPKRVLARLDAKAKKAGENRSAFIAHLALTA
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|