Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpA-higA/BrnT_toxin-HTH |
Location | 437324..437921 | Replicon | chromosome |
Accession | NZ_LT606946 | ||
Organism | Polynucleobacter necessarius isolate PPGSP5 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | - |
Locus tag | DXE44_RS02350 | Protein ID | WP_114652349.1 |
Coordinates | 437324..437602 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | DXE44_RS10230 | Protein ID | WP_197712901.1 |
Coordinates | 437718..437921 (+) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE44_RS02325 | 432883..433401 | + | 519 | WP_114652338.1 | response regulator transcription factor | - |
DXE44_RS02330 | 433486..434526 | + | 1041 | WP_114652340.1 | helix-turn-helix domain-containing protein | - |
DXE44_RS02335 | 434561..434899 | - | 339 | WP_114652342.1 | P-II family nitrogen regulator | - |
DXE44_RS02340 | 434951..436570 | - | 1620 | WP_114652345.1 | NAD+ synthase | - |
DXE44_RS02345 | 436588..437124 | - | 537 | WP_114652347.1 | inorganic diphosphatase | - |
DXE44_RS02350 | 437324..437602 | + | 279 | WP_114652349.1 | BrnT family toxin | Toxin |
DXE44_RS10230 | 437718..437921 | + | 204 | WP_197712901.1 | helix-turn-helix domain-containing protein | Antitoxin |
DXE44_RS02360 | 437989..438945 | - | 957 | WP_114652353.1 | thioredoxin-disulfide reductase | - |
DXE44_RS02365 | 438985..441297 | + | 2313 | WP_114652355.1 | DNA translocase FtsK | - |
DXE44_RS02370 | 441257..442000 | + | 744 | WP_197712808.1 | outer membrane lipoprotein carrier protein LolA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 11122.66 Da Isoelectric Point: 7.9955
>T293294 WP_114652349.1 NZ_LT606946:437324-437602 [Polynucleobacter necessarius]
MDFEWDMAKSDLCQISRNFDFTYVVSVFIDLNLLIERDQRWDYGEERFRALGLLSEKVFVVIYTKRPAAIRIISARRANR
REVRRYEENHSS
MDFEWDMAKSDLCQISRNFDFTYVVSVFIDLNLLIERDQRWDYGEERFRALGLLSEKVFVVIYTKRPAAIRIISARRANR
REVRRYEENHSS
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|