Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 176914..177557 Replicon chromosome
Accession NZ_LT606946
Organism Polynucleobacter necessarius isolate PPGSP5

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag DXE44_RS00975 Protein ID WP_114651925.1
Coordinates 176914..177318 (-) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag DXE44_RS00980 Protein ID WP_114651927.1
Coordinates 177318..177557 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE44_RS00935 171949..173166 + 1218 WP_114651916.1 exodeoxyribonuclease VII large subunit -
DXE44_RS00940 173220..173498 + 279 WP_114651917.1 type II toxin-antitoxin system RelE/ParE family toxin -
DXE44_RS00945 173523..173840 + 318 WP_114651919.1 HigA family addiction module antidote protein -
DXE44_RS00950 173815..174078 - 264 WP_114651920.1 type II toxin-antitoxin system HicB family antitoxin -
DXE44_RS00955 174137..175177 - 1041 WP_114651922.1 UDP-N-acetylmuramate dehydrogenase -
DXE44_RS00960 175295..175780 + 486 WP_114654296.1 YajQ family cyclic di-GMP-binding protein -
DXE44_RS00965 175789..175968 + 180 WP_114651923.1 hypothetical protein -
DXE44_RS00970 175940..176872 + 933 WP_114651924.1 site-specific tyrosine recombinase XerD -
DXE44_RS00975 176914..177318 - 405 WP_114651925.1 tRNA(fMet)-specific endonuclease VapC Toxin
DXE44_RS00980 177318..177557 - 240 WP_114651927.1 antitoxin Antitoxin
DXE44_RS00985 177655..178290 + 636 WP_114651928.1 glycerol-3-phosphate 1-O-acyltransferase PlsY -
DXE44_RS00990 178287..178658 + 372 WP_114651930.1 MAPEG family protein -
DXE44_RS00995 178700..179479 + 780 WP_114651931.1 GTP cyclohydrolase I -
DXE44_RS01000 179483..179707 + 225 WP_114651933.1 hypothetical protein -
DXE44_RS01005 179875..180183 + 309 WP_114651934.1 high-potential iron-sulfur protein -
DXE44_RS01010 180415..180837 + 423 WP_197712788.1 HPP family protein -
DXE44_RS10040 180887..181033 - 147 WP_162785825.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(9-58)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 15116.51 Da        Isoelectric Point: 6.3336

>T293293 WP_114651925.1 NZ_LT606946:c177318-176914 [Polynucleobacter necessarius]
MLKYLLDTNIVIYVLKRRPVEVLKMFNTNASRMAISSITLSELIYGAEKSPNVDKNLEAIEEFISHLEVLPYDAKTSQHY
GQIKAALEKKGEVIGEIDIHIAAHAISQGLILVTNNLHEFKRVANLALENWVET

Download         Length: 405 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 9098.46 Da        Isoelectric Point: 10.8980

>AT293293 WP_114651927.1 NZ_LT606946:c177557-177318 [Polynucleobacter necessarius]
MSIAITTVFTNNRSQAVRLPAEARLPDEVKKVIVRIRGRERIITPLENTWDNFFLSGPSVSNDFMNERGEQKPVKRKDL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References