Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 176914..177557 | Replicon | chromosome |
| Accession | NZ_LT606946 | ||
| Organism | Polynucleobacter necessarius isolate PPGSP5 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | DXE44_RS00975 | Protein ID | WP_114651925.1 |
| Coordinates | 176914..177318 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | DXE44_RS00980 | Protein ID | WP_114651927.1 |
| Coordinates | 177318..177557 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE44_RS00935 | 171949..173166 | + | 1218 | WP_114651916.1 | exodeoxyribonuclease VII large subunit | - |
| DXE44_RS00940 | 173220..173498 | + | 279 | WP_114651917.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| DXE44_RS00945 | 173523..173840 | + | 318 | WP_114651919.1 | HigA family addiction module antidote protein | - |
| DXE44_RS00950 | 173815..174078 | - | 264 | WP_114651920.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| DXE44_RS00955 | 174137..175177 | - | 1041 | WP_114651922.1 | UDP-N-acetylmuramate dehydrogenase | - |
| DXE44_RS00960 | 175295..175780 | + | 486 | WP_114654296.1 | YajQ family cyclic di-GMP-binding protein | - |
| DXE44_RS00965 | 175789..175968 | + | 180 | WP_114651923.1 | hypothetical protein | - |
| DXE44_RS00970 | 175940..176872 | + | 933 | WP_114651924.1 | site-specific tyrosine recombinase XerD | - |
| DXE44_RS00975 | 176914..177318 | - | 405 | WP_114651925.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| DXE44_RS00980 | 177318..177557 | - | 240 | WP_114651927.1 | antitoxin | Antitoxin |
| DXE44_RS00985 | 177655..178290 | + | 636 | WP_114651928.1 | glycerol-3-phosphate 1-O-acyltransferase PlsY | - |
| DXE44_RS00990 | 178287..178658 | + | 372 | WP_114651930.1 | MAPEG family protein | - |
| DXE44_RS00995 | 178700..179479 | + | 780 | WP_114651931.1 | GTP cyclohydrolase I | - |
| DXE44_RS01000 | 179483..179707 | + | 225 | WP_114651933.1 | hypothetical protein | - |
| DXE44_RS01005 | 179875..180183 | + | 309 | WP_114651934.1 | high-potential iron-sulfur protein | - |
| DXE44_RS01010 | 180415..180837 | + | 423 | WP_197712788.1 | HPP family protein | - |
| DXE44_RS10040 | 180887..181033 | - | 147 | WP_162785825.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15116.51 Da Isoelectric Point: 6.3336
>T293293 WP_114651925.1 NZ_LT606946:c177318-176914 [Polynucleobacter necessarius]
MLKYLLDTNIVIYVLKRRPVEVLKMFNTNASRMAISSITLSELIYGAEKSPNVDKNLEAIEEFISHLEVLPYDAKTSQHY
GQIKAALEKKGEVIGEIDIHIAAHAISQGLILVTNNLHEFKRVANLALENWVET
MLKYLLDTNIVIYVLKRRPVEVLKMFNTNASRMAISSITLSELIYGAEKSPNVDKNLEAIEEFISHLEVLPYDAKTSQHY
GQIKAALEKKGEVIGEIDIHIAAHAISQGLILVTNNLHEFKRVANLALENWVET
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|