Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1900875..1901545 | Replicon | chromosome |
Accession | NZ_LT605585 | ||
Organism | Brucella inopinata strain 141012304 isolate Brucella sp. |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | BR141012304_RS09040 | Protein ID | WP_008504608.1 |
Coordinates | 1900875..1901279 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | D1CXH4 |
Locus tag | BR141012304_RS09045 | Protein ID | WP_008504606.1 |
Coordinates | 1901276..1901545 (-) | Length | 90 a.a. |
Genomic Context
Location: 1896546..1896779 (234 bp)
Type: Others
Protein ID: WP_002963968.1
Type: Others
Protein ID: WP_002963968.1
Location: 1896964..1897296 (333 bp)
Type: Others
Protein ID: WP_008505520.1
Type: Others
Protein ID: WP_008505520.1
Location: 1897565..1898830 (1266 bp)
Type: Others
Protein ID: WP_070997981.1
Type: Others
Protein ID: WP_070997981.1
Location: 1902627..1903598 (972 bp)
Type: Others
Protein ID: WP_070997983.1
Type: Others
Protein ID: WP_070997983.1
Location: 1903870..1904283 (414 bp)
Type: Others
Protein ID: WP_008935646.1
Type: Others
Protein ID: WP_008935646.1
Location: 1898884..1899711 (828 bp)
Type: Others
Protein ID: WP_070997982.1
Type: Others
Protein ID: WP_070997982.1
Location: 1899698..1900579 (882 bp)
Type: Others
Protein ID: WP_002969416.1
Type: Others
Protein ID: WP_002969416.1
Location: 1900875..1901279 (405 bp)
Type: Toxin
Protein ID: WP_008504608.1
Type: Toxin
Protein ID: WP_008504608.1
Location: 1901276..1901545 (270 bp)
Type: Antitoxin
Protein ID: WP_008504606.1
Type: Antitoxin
Protein ID: WP_008504606.1
Location: 1901675..1902292 (618 bp)
Type: Others
Protein ID: WP_002967582.1
Type: Others
Protein ID: WP_002967582.1
Location: 1904328..1904525 (198 bp)
Type: Others
Protein ID: WP_070997719.1
Type: Others
Protein ID: WP_070997719.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BR141012304_RS09015 | 1896546..1896779 | + | 234 | WP_002963968.1 | BolA family transcriptional regulator | - |
BR141012304_RS09020 | 1896964..1897296 | + | 333 | WP_008505520.1 | Grx4 family monothiol glutaredoxin | - |
BR141012304_RS09025 | 1897565..1898830 | + | 1266 | WP_070997981.1 | multidrug effflux MFS transporter | - |
BR141012304_RS09030 | 1898884..1899711 | - | 828 | WP_070997982.1 | inositol monophosphatase family protein | - |
BR141012304_RS09035 | 1899698..1900579 | - | 882 | WP_002969416.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
BR141012304_RS09040 | 1900875..1901279 | - | 405 | WP_008504608.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
BR141012304_RS09045 | 1901276..1901545 | - | 270 | WP_008504606.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
BR141012304_RS09050 | 1901675..1902292 | - | 618 | WP_002967582.1 | 30S ribosomal protein S4 | - |
BR141012304_RS09055 | 1902627..1903598 | + | 972 | WP_070997983.1 | extensin family protein | - |
BR141012304_RS09060 | 1903870..1904283 | + | 414 | WP_008935646.1 | hypothetical protein | - |
BR141012304_RS09065 | 1904328..1904525 | - | 198 | WP_070997719.1 | DUF3008 family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14365.66 Da Isoelectric Point: 5.6366
>T293290 WP_008504608.1 NZ_LT605585:c1901279-1900875 [Brucella inopinata]
MSKLYMLDTNIVSDLARNPHGPVAKHIARVGADAICVSIITACELRYGCAKKGSPRLLAQIEAILDSIEILPLDVPADTE
YGGIRAELEADGKPIGPNDFLIAAHAYALGAVLVTANVGEFTRIRKLAVENWLN
MSKLYMLDTNIVSDLARNPHGPVAKHIARVGADAICVSIITACELRYGCAKKGSPRLLAQIEAILDSIEILPLDVPADTE
YGGIRAELEADGKPIGPNDFLIAAHAYALGAVLVTANVGEFTRIRKLAVENWLN
Download Length: 405 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7L7MKG1 |