Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 3501048..3501701 | Replicon | chromosome |
Accession | NZ_LT605059 | ||
Organism | Acinetobacter baumannii strain NCTC7364 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | B5474_RS16685 | Protein ID | WP_079549007.1 |
Coordinates | 3501048..3501437 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | B5474_RS16690 | Protein ID | WP_001288211.1 |
Coordinates | 3501444..3501701 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B5474_RS16670 | 3496166..3498361 | - | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
B5474_RS16675 | 3498549..3499115 | - | 567 | WP_000651536.1 | rhombosortase | - |
B5474_RS16680 | 3499193..3500278 | - | 1086 | WP_079549006.1 | hypothetical protein | - |
B5474_RS16685 | 3501048..3501437 | - | 390 | WP_079549007.1 | hypothetical protein | Toxin |
B5474_RS16690 | 3501444..3501701 | - | 258 | WP_001288211.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
B5474_RS16695 | 3501889..3503061 | + | 1173 | WP_079549008.1 | acyl-CoA dehydrogenase family protein | - |
B5474_RS16700 | 3503110..3504600 | - | 1491 | WP_000415132.1 | NAD(P)/FAD-dependent oxidoreductase | - |
B5474_RS16705 | 3504782..3505159 | - | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
B5474_RS16710 | 3505178..3506185 | - | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15701.12 Da Isoelectric Point: 10.4623
>T293289 WP_079549007.1 NZ_LT605059:c3501437-3501048 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKKLISIIWFDQMSLAEWKKLKILEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKKLISIIWFDQMSLAEWKKLKILEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|