Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YoeB-YefM |
| Location | 3582088..3582593 | Replicon | chromosome |
| Accession | NZ_LT604072 | ||
| Organism | Xanthomonas translucens pv. translucens DSM 18974 isolate peng1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A1C3TRG2 |
| Locus tag | BFP94_RS14755 | Protein ID | WP_003479798.1 |
| Coordinates | 3582336..3582593 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | relE | Uniprot ID | A0A1C3TRJ9 |
| Locus tag | BFP94_RS14750 | Protein ID | WP_003468816.1 |
| Coordinates | 3582088..3582339 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BFP94_RS14725 | 3577159..3578394 | + | 1236 | WP_065899003.1 | citrate synthase family protein | - |
| BFP94_RS14730 | 3579561..3580115 | + | 555 | WP_003479802.1 | hypothetical protein | - |
| BFP94_RS14735 | 3580151..3580594 | - | 444 | WP_003479801.1 | nuclear transport factor 2 family protein | - |
| BFP94_RS14740 | 3580716..3581438 | + | 723 | WP_003479800.1 | ArsR family transcriptional regulator | - |
| BFP94_RS14745 | 3581435..3581979 | - | 545 | Protein_3004 | endonuclease | - |
| BFP94_RS14750 | 3582088..3582339 | + | 252 | WP_003468816.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| BFP94_RS14755 | 3582336..3582593 | + | 258 | WP_003479798.1 | Txe/YoeB family addiction module toxin | Toxin |
| BFP94_RS14765 | 3583228..3583581 | - | 354 | WP_003479797.1 | PilZ domain-containing protein | - |
| BFP94_RS14770 | 3583578..3584555 | - | 978 | WP_003479796.1 | DNA polymerase III subunit delta' | - |
| BFP94_RS14775 | 3584552..3585220 | - | 669 | WP_003479795.1 | dTMP kinase | - |
| BFP94_RS14780 | 3585217..3586284 | - | 1068 | WP_172837969.1 | endolytic transglycosylase MltG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10156.61 Da Isoelectric Point: 9.7381
>T293287 WP_003479798.1 NZ_LT604072:3582336-3582593 [Xanthomonas translucens pv. translucens DSM 18974]
VTLQFSDNAWEDDLYWQQTDKKMLKRINDLIKAIQRDPFQGVGKPERLRHALAGYWSRRINDEHRIVYKVEAGVLLIAQV
RYHYA
VTLQFSDNAWEDDLYWQQTDKKMLKRINDLIKAIQRDPFQGVGKPERLRHALAGYWSRRINDEHRIVYKVEAGVLLIAQV
RYHYA
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C3TRG2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C3TRJ9 |