Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1383506..1384425 | Replicon | chromosome |
Accession | NZ_LT603683 | ||
Organism | Bacillus glycinifermentans isolate BGLY |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A1C3SBI7 |
Locus tag | BGLY_RS06990 | Protein ID | WP_046131131.1 |
Coordinates | 1383679..1384425 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | - |
Locus tag | BGLY_RS06985 | Protein ID | WP_046131317.1 |
Coordinates | 1383506..1383679 (-) | Length | 58 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BGLY_RS06965 | 1378569..1379666 | + | 1098 | WP_046131134.1 | mannonate dehydratase | - |
BGLY_RS06970 | 1379642..1380490 | + | 849 | WP_046131133.1 | SDR family oxidoreductase | - |
BGLY_RS06975 | 1380503..1381522 | + | 1020 | WP_046131132.1 | zinc-binding alcohol dehydrogenase family protein | - |
BGLY_RS06980 | 1381557..1382830 | + | 1274 | Protein_1326 | MFS transporter | - |
BGLY_RS06985 | 1383506..1383679 | - | 174 | WP_046131317.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
BGLY_RS06990 | 1383679..1384425 | - | 747 | WP_046131131.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
BGLY_RS06995 | 1384541..1385539 | - | 999 | WP_046131130.1 | inorganic phosphate transporter | - |
BGLY_RS07000 | 1385552..1386169 | - | 618 | WP_006638544.1 | DUF47 domain-containing protein | - |
BGLY_RS07005 | 1386493..1388253 | + | 1761 | WP_046131129.1 | gamma-glutamyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29645.05 Da Isoelectric Point: 4.6123
>T293285 WP_046131131.1 NZ_LT603683:c1384425-1383679 [Bacillus glycinifermentans]
MLLFYQFSVWVIVLALALYVFAVWRFEKKMKEKTIAIRKTWYLLYVIGAALYWTYDPQSIFSNWLHYLIVAVFFTLTDAF
IFLNAYFKKLGTNELATDTRELLEENNDLLHTYQNRLKTYQYLLKNEPIHIYYGDIEAYAEGIEKLIKRFAEKMNISAAL
CEYNSQESKDHLLEHMENRFAVQEKLDRKDVYYEENGKMVLIPFSIHEYDYVMKLTSEDLVTEFDYLLFTSLTSIYDLLL
PNEEEGDE
MLLFYQFSVWVIVLALALYVFAVWRFEKKMKEKTIAIRKTWYLLYVIGAALYWTYDPQSIFSNWLHYLIVAVFFTLTDAF
IFLNAYFKKLGTNELATDTRELLEENNDLLHTYQNRLKTYQYLLKNEPIHIYYGDIEAYAEGIEKLIKRFAEKMNISAAL
CEYNSQESKDHLLEHMENRFAVQEKLDRKDVYYEENGKMVLIPFSIHEYDYVMKLTSEDLVTEFDYLLFTSLTSIYDLLL
PNEEEGDE
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|