Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 605362..605998 | Replicon | chromosome |
| Accession | NZ_LT603683 | ||
| Organism | Bacillus glycinifermentans isolate BGLY | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | M5P3Q9 |
| Locus tag | BGLY_RS03005 | Protein ID | WP_003179128.1 |
| Coordinates | 605648..605998 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A6I7F8B4 |
| Locus tag | BGLY_RS03000 | Protein ID | WP_026585993.1 |
| Coordinates | 605362..605643 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BGLY_RS02980 | 600524..602005 | + | 1482 | WP_046132202.1 | PH domain-containing protein | - |
| BGLY_RS02985 | 602002..602601 | - | 600 | WP_046132201.1 | rhomboid family intramembrane serine protease | - |
| BGLY_RS02990 | 602883..603899 | + | 1017 | WP_099047092.1 | outer membrane lipoprotein carrier protein LolA | - |
| BGLY_RS02995 | 604093..605253 | + | 1161 | WP_046132199.1 | alanine racemase | - |
| BGLY_RS03000 | 605362..605643 | + | 282 | WP_026585993.1 | hypothetical protein | Antitoxin |
| BGLY_RS03005 | 605648..605998 | + | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| BGLY_RS03010 | 606072..606941 | + | 870 | WP_173427511.1 | STAS domain-containing protein | - |
| BGLY_RS03015 | 606944..607309 | + | 366 | WP_046132197.1 | STAS domain-containing protein | - |
| BGLY_RS03020 | 607312..607713 | + | 402 | WP_046132196.1 | anti-sigma regulatory factor | - |
| BGLY_RS03025 | 607724..608731 | + | 1008 | WP_046132195.1 | PP2C family protein-serine/threonine phosphatase | - |
| BGLY_RS03030 | 608790..609116 | + | 327 | WP_046132194.1 | anti-sigma factor antagonist | - |
| BGLY_RS03035 | 609116..609598 | + | 483 | WP_046132193.1 | anti-sigma B factor RsbW | - |
| BGLY_RS03040 | 609564..610355 | + | 792 | WP_046132218.1 | RNA polymerase sigma factor SigB | - |
| BGLY_RS03045 | 610352..610951 | + | 600 | WP_046132192.1 | SpoIIE family protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T293284 WP_003179128.1 NZ_LT603683:605648-605998 [Bacillus glycinifermentans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6I7FHI4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6I7F8B4 |