Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 5043606..5044438 | Replicon | chromosome |
Accession | NZ_LT601384 | ||
Organism | Escherichia coli isolate NCTC86EC |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | NCTC86EC_RS24835 | Protein ID | WP_058101701.1 |
Coordinates | 5044064..5044438 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NQ68 |
Locus tag | NCTC86EC_RS24830 | Protein ID | WP_001540478.1 |
Coordinates | 5043606..5043974 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NCTC86EC_RS24795 | 5040724..5040870 | + | 147 | WP_059333225.1 | DUF905 family protein | - |
NCTC86EC_RS24800 | 5041037..5041855 | + | 819 | WP_001234716.1 | DUF945 domain-containing protein | - |
NCTC86EC_RS28935 | 5041855..5042028 | + | 174 | WP_001183321.1 | hypothetical protein | - |
NCTC86EC_RS24810 | 5042194..5042667 | + | 474 | WP_068879497.1 | antirestriction protein | - |
NCTC86EC_RS24815 | 5042683..5043159 | + | 477 | WP_001186786.1 | RadC family protein | - |
NCTC86EC_RS24820 | 5043222..5043443 | + | 222 | WP_021532904.1 | DUF987 domain-containing protein | - |
NCTC86EC_RS24830 | 5043606..5043974 | + | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NCTC86EC_RS24835 | 5044064..5044438 | + | 375 | WP_058101701.1 | TA system toxin CbtA family protein | Toxin |
NCTC86EC_RS24840 | 5044435..5044926 | + | 492 | WP_001586604.1 | hypothetical protein | - |
NCTC86EC_RS24845 | 5044943..5045119 | + | 177 | WP_001586605.1 | DUF957 domain-containing protein | - |
NCTC86EC_RS29030 | 5045219..5045377 | + | 159 | WP_001467148.1 | hypothetical protein | - |
NCTC86EC_RS24850 | 5046030..5048921 | + | 2892 | WP_000580534.1 | DEAD/DEAH box helicase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | fimB / fimE | 5037807..5063988 | 26181 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13796.72 Da Isoelectric Point: 7.9047
>T293282 WP_058101701.1 NZ_LT601384:5044064-5044438 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT293282 WP_001540478.1 NZ_LT601384:5043606-5043974 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|