Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4765265..4766100 | Replicon | chromosome |
| Accession | NZ_LT601384 | ||
| Organism | Escherichia coli isolate NCTC86EC | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A5F0P695 |
| Locus tag | NCTC86EC_RS23350 | Protein ID | WP_022645116.1 |
| Coordinates | 4765265..4765642 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | Q5I3J0 |
| Locus tag | NCTC86EC_RS23355 | Protein ID | WP_001280951.1 |
| Coordinates | 4765732..4766100 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NCTC86EC_RS28715 | 4761631..4763170 | - | 1540 | Protein_4435 | lysine decarboxylation/transport transcriptional activator CadC | - |
| NCTC86EC_RS23340 | 4763919..4764761 | - | 843 | WP_022645115.1 | DUF4942 domain-containing protein | - |
| NCTC86EC_RS28720 | 4764846..4765040 | - | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| NCTC86EC_RS28725 | 4765119..4765268 | - | 150 | Protein_4438 | hypothetical protein | - |
| NCTC86EC_RS23350 | 4765265..4765642 | - | 378 | WP_022645116.1 | TA system toxin CbtA family protein | Toxin |
| NCTC86EC_RS23355 | 4765732..4766100 | - | 369 | WP_001280951.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NCTC86EC_RS23365 | 4766263..4766484 | - | 222 | WP_021532904.1 | DUF987 domain-containing protein | - |
| NCTC86EC_RS23370 | 4766547..4767023 | - | 477 | WP_001186786.1 | RadC family protein | - |
| NCTC86EC_RS23375 | 4767039..4767518 | - | 480 | WP_001564060.1 | antirestriction protein | - |
| NCTC86EC_RS23380 | 4767784..4768602 | - | 819 | WP_001175165.1 | DUF945 domain-containing protein | - |
| NCTC86EC_RS23385 | 4768692..4768925 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| NCTC86EC_RS23390 | 4768931..4769608 | - | 678 | WP_001097302.1 | hypothetical protein | - |
| NCTC86EC_RS23395 | 4769756..4770436 | - | 681 | WP_001282921.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4754143..4799856 | 45713 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14021.99 Da Isoelectric Point: 7.8045
>T293281 WP_022645116.1 NZ_LT601384:c4765642-4765265 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGIALCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGIALCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13699.56 Da Isoelectric Point: 7.0268
>AT293281 WP_001280951.1 NZ_LT601384:c4766100-4765732 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5F0P695 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q5I3J0 |