Detailed information of TA system TA293276

Bioinformatically predicted

Overview

TA module

• Type: IV
• Classification (family/domain): yeeUV (cbtA-cbeA)/CbtA-CbeA
• Location: 3454986..3455781
• Replicon: chromosome
• Accession: NZ_LT601384
• Organism: Escherichia coli isolate NCTC86EC

Toxin (Protein)

• Gene name: yeeV
• Uniprot ID: -
• Locus tag: NCTC86EC_RS17005
• Protein ID: WP_068879483.1
• Coordinates: 3455407..3455781 (+)
• Length: 125 a.a.

Antitoxin (Protein)

• Gene name: yeeU
• Uniprot ID: -
• Locus tag: NCTC86EC_RS17000
• Protein ID: WP_001522275.1
• Coordinates: 3454986..3455360 (+)
• Length: 125 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NCTC86EC_RS16970	3450148..3450966	+	819	WP_001522287.1	DUF945 domain-containing protein	-
NCTC86EC_RS28905	3450966..3451142	+	177	WP_001522285.1	hypothetical protein	-
NCTC86EC_RS16975	3451237..3451710	+	474	WP_001522284.1	antirestriction protein	-
NCTC86EC_RS16980	3451725..3452201	+	477	WP_001186724.1	RadC family protein	-
NCTC86EC_RS16985	3452382..3453881	+	1500	WP_001522281.1	IS21-like element ISEc10 family transposase	-
NCTC86EC_RS16990	3453878..3454633	+	756	WP_001522280.1	IS21-like element ISEc10 family helper ATPase IstB	-
NCTC86EC_RS16995	3454685..3454906	+	222	WP_023909484.1	DUF987 domain-containing protein	-
NCTC86EC_RS17000	3454986..3455360	+	375	WP_001522275.1	type IV toxin-antitoxin system toxin CbtA	Antitoxin
NCTC86EC_RS17005	3455407..3455781	+	375	WP_068879483.1	TA system toxin CbtA family protein	Toxin
NCTC86EC_RS17010	3455778..3456269	+	492	WP_001522269.1	hypothetical protein	-
NCTC86EC_RS17015	3456281..3456478	+	198	WP_001522268.1	DUF957 domain-containing protein	-
NCTC86EC_RS17020	3456563..3457429	+	867	WP_066009586.1	DUF4942 domain-containing protein	-
NCTC86EC_RS17025	3457501..3457764	+	264	WP_001143297.1	type II toxin-antitoxin system ParD family antitoxin	-
NCTC86EC_RS17030	3457761..3458087	+	327	WP_001522265.1	type II toxin-antitoxin system RelE/ParE family toxin	-
NCTC86EC_RS28910	3458579..3458734	+	156	WP_000729639.1	hypothetical protein	-
NCTC86EC_RS17040	3459545..3460528	+	984	WP_066008910.1	KpsF/GutQ family sugar-phosphate isomerase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integrative and Conjugative Element	-	kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / kpsT / kpsM / gspM / gspL / gspK	3423380..3529075	105695

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• CbtA toxin of type IV toxin-antitoxin system (1-112)

Antitoxin

• Antitoxin CbeA (19-117)

Sequences

Toxin

Protein

• Length: 125 a.a.
• Molecular weight: 14026.02 Da
• Isoelectric Point: 8.2905

>T293276 WP_068879483.1 NZ_LT601384:3455407-3455781 [Escherichia coli]
MKTLSDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTLFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRSNYRTVNNITQGKHPEAK

Nucleotide

• Length: 375 bp

Antitoxin

Protein

• Length: 125 a.a.
• Molecular weight: 13630.35 Da
• Isoelectric Point: 5.5051

>AT293276 WP_001522275.1 NZ_LT601384:3454986-3455360 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Nucleotide

• Length: 375 bp