Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3327405..3328059 | Replicon | chromosome |
Accession | NZ_LT601384 | ||
Organism | Escherichia coli isolate NCTC86EC |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | NCTC86EC_RS16355 | Protein ID | WP_000244777.1 |
Coordinates | 3327405..3327812 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NCTC86EC_RS16360 | Protein ID | WP_000354046.1 |
Coordinates | 3327793..3328059 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NCTC86EC_RS16335 | 3323362..3325095 | - | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NCTC86EC_RS16340 | 3325101..3325811 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NCTC86EC_RS16345 | 3325836..3326732 | - | 897 | WP_042091714.1 | site-specific tyrosine recombinase XerD | - |
NCTC86EC_RS16350 | 3326844..3327365 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NCTC86EC_RS16355 | 3327405..3327812 | - | 408 | WP_000244777.1 | toxin CptA | Toxin |
NCTC86EC_RS16360 | 3327793..3328059 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NCTC86EC_RS16365 | 3328302..3329282 | + | 981 | WP_001514522.1 | tRNA-modifying protein YgfZ | - |
NCTC86EC_RS16370 | 3329478..3330137 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
NCTC86EC_RS16375 | 3330301..3330612 | - | 312 | WP_001514524.1 | N(4)-acetylcytidine aminohydrolase | - |
NCTC86EC_RS16380 | 3330657..3332090 | + | 1434 | WP_001514525.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T293275 WP_000244777.1 NZ_LT601384:c3327812-3327405 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |