Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 2913372..2914066 | Replicon | chromosome |
| Accession | NZ_LT601384 | ||
| Organism | Escherichia coli isolate NCTC86EC | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | NCTC86EC_RS14310 | Protein ID | WP_066009356.1 |
| Coordinates | 2913372..2913740 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | NCTC86EC_RS14315 | Protein ID | WP_077249034.1 |
| Coordinates | 2913761..2914066 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NCTC86EC_RS14290 | 2908545..2909501 | + | 957 | WP_000643333.1 | aldehyde oxidoreductase FAD-binding subunit PaoB | - |
| NCTC86EC_RS14295 | 2909498..2911696 | + | 2199 | WP_000667026.1 | aldehyde oxidoreductase molybdenum-binding subunit PaoC | - |
| NCTC86EC_RS14300 | 2911706..2912662 | + | 957 | WP_000121359.1 | molybdenum cofactor insertion chaperone PaoD | - |
| NCTC86EC_RS14305 | 2912713..2913051 | + | 339 | Protein_2737 | LysR family transcriptional regulator | - |
| NCTC86EC_RS14310 | 2913372..2913740 | - | 369 | WP_066009356.1 | TA system toxin CbtA family protein | Toxin |
| NCTC86EC_RS14315 | 2913761..2914066 | - | 306 | WP_077249034.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NCTC86EC_RS14320 | 2914170..2914814 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| NCTC86EC_RS14325 | 2914833..2915054 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NCTC86EC_RS14330 | 2915123..2915599 | - | 477 | WP_001424026.1 | RadC family protein | - |
| NCTC86EC_RS14335 | 2915615..2916088 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| NCTC86EC_RS14340 | 2916430..2917251 | - | 822 | WP_001234565.1 | DUF945 domain-containing protein | - |
| NCTC86EC_RS28550 | 2917352..2917560 | - | 209 | Protein_2745 | DUF905 family protein | - |
| NCTC86EC_RS14350 | 2917661..2918116 | - | 456 | WP_000581506.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fdeC / ykgK/ecpR / yagZ/ecpA / yagY/ecpB / yagX/ecpC / yagW/ecpD / yagV/ecpE | 2887999..2938777 | 50778 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13611.75 Da Isoelectric Point: 7.7465
>T293271 WP_066009356.1 NZ_LT601384:c2913740-2913372 [Escherichia coli]
MNTLPATISPAAKPCPSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDASITLANAVNFLVEKYELVRIDRNGF
NSQVQAPYLTATDILQARKACGLMSRCSYRDVSNIVLSRSRL
MNTLPATISPAAKPCPSPVAVWQMLLTRLLEQHYGLMLSDTPFSDETVIKEHIDASITLANAVNFLVEKYELVRIDRNGF
NSQVQAPYLTATDILQARKACGLMSRCSYRDVSNIVLSRSRL
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|