Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2124973..2125817 | Replicon | chromosome |
Accession | NZ_LT601384 | ||
Organism | Escherichia coli isolate NCTC86EC |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | B1LJY4 |
Locus tag | NCTC86EC_RS10435 | Protein ID | WP_000854686.1 |
Coordinates | 2124973..2125356 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A8E0J1S3 |
Locus tag | NCTC86EC_RS10440 | Protein ID | WP_001285602.1 |
Coordinates | 2125437..2125817 (-) | Length | 127 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NCTC86EC_RS10405 | 2121648..2122352 | + | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
NCTC86EC_RS10410 | 2122637..2122855 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
NCTC86EC_RS10420 | 2123347..2124189 | - | 843 | WP_068879455.1 | DUF4942 domain-containing protein | - |
NCTC86EC_RS10425 | 2124274..2124471 | - | 198 | WP_000839256.1 | DUF957 domain-containing protein | - |
NCTC86EC_RS10430 | 2124488..2124976 | - | 489 | WP_001054233.1 | hypothetical protein | - |
NCTC86EC_RS10435 | 2124973..2125356 | - | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
NCTC86EC_RS10440 | 2125437..2125817 | - | 381 | WP_001285602.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NCTC86EC_RS10445 | 2125828..2126511 | - | 684 | WP_000086768.1 | hypothetical protein | - |
NCTC86EC_RS10450 | 2126530..2126751 | - | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
NCTC86EC_RS10455 | 2126814..2127290 | - | 477 | WP_021543704.1 | RadC family protein | - |
NCTC86EC_RS10460 | 2127306..2127791 | - | 486 | WP_000214307.1 | antirestriction protein | - |
NCTC86EC_RS10465 | 2127883..2128701 | - | 819 | WP_068879456.1 | DUF945 domain-containing protein | - |
NCTC86EC_RS10470 | 2128802..2129035 | - | 234 | WP_001119727.1 | DUF905 family protein | - |
NCTC86EC_RS10475 | 2129114..2129569 | - | 456 | WP_000581502.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T293268 WP_000854686.1 NZ_LT601384:c2125356-2124973 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13938.69 Da Isoelectric Point: 5.0823
>AT293268 WP_001285602.1 NZ_LT601384:c2125817-2125437 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|