Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1913890..1914688 Replicon chromosome
Accession NZ_LT601384
Organism Escherichia coli isolate NCTC86EC

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag NCTC86EC_RS09440 Protein ID WP_066009386.1
Coordinates 1913890..1914267 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7UP42
Locus tag NCTC86EC_RS09445 Protein ID WP_001280955.1
Coordinates 1914314..1914688 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NCTC86EC_RS09420 1910117..1910944 - 828 WP_031326415.1 DUF4942 domain-containing protein -
NCTC86EC_RS09425 1910998..1912497 + 1500 WP_001735705.1 IS21-like element ISEc10 family transposase -
NCTC86EC_RS09430 1912494..1913249 + 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
NCTC86EC_RS28400 1913298..1913393 - 96 WP_023910462.1 DUF957 domain-containing protein -
NCTC86EC_RS09435 1913405..1913893 - 489 WP_044704957.1 hypothetical protein -
NCTC86EC_RS09440 1913890..1914267 - 378 WP_066009386.1 TA system toxin CbtA family protein Toxin
NCTC86EC_RS09445 1914314..1914688 - 375 WP_001280955.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NCTC86EC_RS09455 1914851..1915072 - 222 WP_001220314.1 DUF987 domain-containing protein -
NCTC86EC_RS09460 1915135..1915611 - 477 WP_001186192.1 RadC family protein -
NCTC86EC_RS09465 1915627..1916112 - 486 WP_023910464.1 antirestriction protein -
NCTC86EC_RS09470 1916203..1917021 - 819 WP_001234682.1 DUF945 domain-containing protein -
NCTC86EC_RS09480 1917361..1918431 - 1071 WP_053886242.1 patatin-like phospholipase family protein -
NCTC86EC_RS09485 1918428..1919333 - 906 WP_000203541.1 chemotaxis protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgB / csgD / csgE / csgF / csgG 1903125..1916112 12987


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14247.32 Da        Isoelectric Point: 8.2905

>T293267 WP_066009386.1 NZ_LT601384:c1914267-1913890 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13767.59 Da        Isoelectric Point: 6.6248

>AT293267 WP_001280955.1 NZ_LT601384:c1914688-1914314 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9P0D0

References