Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 865820..866652 | Replicon | chromosome |
| Accession | NZ_LT601384 | ||
| Organism | Escherichia coli isolate NCTC86EC | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | NCTC86EC_RS03985 | Protein ID | WP_000854765.1 |
| Coordinates | 865820..866194 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7U9IW59 |
| Locus tag | NCTC86EC_RS03990 | Protein ID | WP_001360327.1 |
| Coordinates | 866284..866652 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NCTC86EC_RS28950 | 861718..862107 | - | 390 | WP_077249349.1 | transposase | - |
| NCTC86EC_RS03965 | 862925..864466 | + | 1542 | WP_068879436.1 | IS21-like element ISEc12 family transposase | - |
| NCTC86EC_RS03970 | 864481..865227 | + | 747 | Protein_765 | IS21-like element ISEc12 family helper ATPase IstB | - |
| NCTC86EC_RS28235 | 865491..865604 | - | 114 | WP_001161660.1 | DUF957 domain-containing protein | - |
| NCTC86EC_RS03980 | 865617..865823 | - | 207 | WP_000976829.1 | hypothetical protein | - |
| NCTC86EC_RS03985 | 865820..866194 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| NCTC86EC_RS03990 | 866284..866652 | - | 369 | WP_001360327.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NCTC86EC_RS04000 | 866815..867036 | - | 222 | WP_023356553.1 | DUF987 domain-containing protein | - |
| NCTC86EC_RS04005 | 867099..867575 | - | 477 | WP_001186774.1 | RadC family protein | - |
| NCTC86EC_RS04010 | 867591..868064 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| NCTC86EC_RS04020 | 868448..869125 | + | 678 | WP_001339397.1 | IS66 family insertion sequence hypothetical protein | - |
| NCTC86EC_RS04025 | 869125..869472 | + | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| NCTC86EC_RS04030 | 869492..871063 | + | 1572 | WP_000381395.1 | IS66 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 859579..871063 | 11484 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T293260 WP_000854765.1 NZ_LT601384:c866194-865820 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.34 Da Isoelectric Point: 5.9598
>AT293260 WP_001360327.1 NZ_LT601384:c866652-866284 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A7ZVJ9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9IW59 |